KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0975Help
Entry
DKAM_0975         CDS       T00817                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00030  Pentose phosphate pathway
dka01100  Metabolic pathways
dka01120  Microbial metabolism in diverse environments
dka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DKAM_0975
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DKAM_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACL11301
UniProt: B8D5C0
LinkDB All DBs
Position
921280..923112
Genome map
AA seq 610 aa AA seqDB search
MYMYGWWGKALLIDLTKSKVKEVSIEPDILHGFIGGRGLAVRLLWDLIPPGVDPLSPYNA
LIVASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGSMASHHLKHSGYDALIITGASKK
PVYLYIENGKVDFRSAEDLWGLDTFTTEEKLVREHGRNIGILEIGPAGEHMVRYATVISQ
KGRSGGRPGMGAVMGSKKLKAIVIKGNMEPPIADKEALRKISEESYKKIQGSDNYDYWIR
QGTMSTIQWSHQNSVLPTMNFREGMWELYETISGDLMEKLKIDRRGCPYCNMQCGNVVSD
DVGEESELDYENVAMLGSNILLENLKRVAEINKLADKLGVDTISLGNSIGFYMEASERGL
VKERVEWGDFKAVREITIDTAYRRGLGAFIAEGVMRMARSIGGEALDFAMHVKGLEVSAY
NCHTTPGMALAYGTSSIGAHHKDAWIISYEVRTDRSSYSRDKVERLIFLQNMRGGMFESL
TTCRLPWVEVGLDLEYYPRFLSAVTGLKWSLDDISVSANRIYTLIRAFWIREYMGWSSSM
DYPPTRWFKHPLTKGPYAGSHLDISKYSEMLKIYYEIRGWDENGVPKKETLIKLGLDFTI
PVLEDIVKLR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgtatggctggtggggtaaggcactactaatagatttaaccaaaagtaaggta
aaagaggtgagcatagagccagatatactacatggattcatcggtggaagaggcctagcg
gttagactcctatgggatctaatccctcccggagtggatccgttatcaccatataatgca
ttaatagtggcctccggtcctctctcagggctaccattacctagtagtggtaaactagtt
gtagcatctaagagcccgctgacaaatggctatggggatggcaatataggttccatggcc
agccaccacttaaagcacagcggctacgatgcactcataatcacaggggcatctaagaaa
cccgtctacctctacattgaaaacggtaaagtagatttcagaagtgccgaggatctatgg
gggcttgacaccttcactactgaggaaaaactggttagagaacatggtagaaacattggc
atacttgaaatcgggccggcgggagagcatatggttagatacgccacagtgatctcccag
aaggggagaagcggagggcgcccaggcatgggtgctgtaatgggtagcaaaaagctgaag
gcgatagtgatcaagggaaacatggagccacctatagccgataaagaggctcttagaaaa
atatctgaggaatcctataagaagatacagggtagcgataactatgattactggattaga
caaggcacaatgtccacaatacagtggagtcatcaaaacagcgtcctacccacaatgaac
tttagggagggtatgtgggagctgtatgaaaccataagcggtgatttaatggaaaaactg
aagatagatagaaggggatgtccttactgtaacatgcagtgcggtaatgttgttagtgat
gatgtaggagaggagagcgaactagactatgagaacgtagcgatgctgggcagtaatata
ttattagagaacttgaaaagggttgccgagataaataagctagctgataaactaggggta
gataccataagtctaggcaactcgatagggttctatatggaagctagcgagagagggcta
gtcaaagagagagttgaatggggagacttcaaagccgtgagagagataaccattgatacg
gcatatagacgcgggctgggagcattcatagctgaaggagttatgaggatggcaaggagt
attggcggtgaggcactcgatttcgccatgcatgtgaagggtttagaggtatctgcatac
aactgtcacacaacccccggaatggccctagcatacggcacatcttctatcggggcccac
cacaaggatgcctggataataagctacgaagttagaacagatagatcatcgtatagcagg
gacaaggttgaacgcttaatcttcctgcaaaacatgcgtggaggaatgtttgagtcgctg
acaacatgtaggcttccatgggttgaagtaggcctcgacctcgagtattacccaagattc
ctttcagctgtaactggtttaaaatggagcctcgacgatataagcgtttctgccaacagg
atctacacgttgataagggcattctggatacgcgaatacatgggttggagtagctcgatg
gactacccgcctaccagatggtttaaacacccacttacaaaaggaccgtatgcaggctca
cacctagatatctctaaatacagtgaaatgttaaagatatactatgaaatacgtggctgg
gatgaaaacggtgtcccaaagaaggagactctcataaagctggggctagacttcacaata
cctgttctagaggacattgtgaagctacggtag

DBGET integrated database retrieval system