KEGG   Desulfurococcus amylolyticus 1221n: DKAM_1140Help
Entry
DKAM_1140         CDS       T00817                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00630  Glyoxylate and dicarboxylate metabolism
dka01100  Metabolic pathways
dka01120  Microbial metabolism in diverse environments
dka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DKAM_1140
Enzymes [BR:dka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DKAM_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697 LigA
Motif
Other DBs
NCBI-ProteinID: ACL11466
UniProt: B8D5T5
LinkDB All DBs
Position
1072426..1073772
Genome map
AA seq 448 aa AA seqDB search
MKLMSGKFEFETYHEYIDKNYTPDPSNDVIAVYRVKPAQGFTIEDAAGGVAAESSTGTWT
SLYNWYDVGRVRRLSGKAYYFKDLDDGSWIVKIAYPVELFEEGNIPGLLASIAGNIFGMK
RVEGLRLEDIYLPKKFLESFKGPSKGLNGVREIFGVKDRPIVGTVPKPKEGYSPEEVEKL
ALELLSGGLDYIKDDENLTSPSFCRFEARAKAIMKVIDKVEKETGERKVWFANITSDIRE
MEKRLRLVADYGNPYIMVDVVITGWSALTYIRDLAEEYGLAIHGHRAMHAAFTRNPYHGI
SMYVLAKLYRIIGIDQLHIGTAGAGKLEGGKLDVIRYAKILREIHFKPDPDDMYHLEQPM
HHIKPAMPVSSGGLHPGNLPPVIEALGTNLVLQIGGGVIGHPDGPRAGALAVRQALEAIM
NNIPLDEYAKTHRELARALEKWGFAKPI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttgatgagtgggaaattcgagtttgaaacataccacgagtacatagacaagaac
tatactcctgaccccagtaacgatgtaatagctgtatacagggttaagcctgcacaggga
ttcactattgaggacgctgcagggggcgtagctgctgagagtagcactggtacgtggacc
agcctttacaattggtacgatgtagggagagttagaaggctgagtggtaaagcatactac
ttcaaagaccttgacgatggatcatggattgtgaaaatagcatacccagtggagttattc
gaggaaggaaatataccgggcctgctggcatccatagctggaaacatatttggtatgaag
cgtgttgaaggattaagactcgaggacatatatctccccaagaaattcctcgagtcattt
aagggacccagtaagggattaaatggtgttagagagatattcggggtaaaggataggcct
atagtaggcacggtgccgaagcccaaggagggttactcaccggaggaagtggagaagctg
gctttagagttgctaagcggtggattagactacataaaagacgacgaaaacctgaccagc
ccaagcttctgtaggttcgaggccagagctaaggccattatgaaggtcattgataaagta
gagaaagagacaggtgagagaaaagtctggttcgccaatattacctccgatatacgtgaa
atggagaagaggctgaggctagtagcagactacggtaacccatacataatggttgatgtc
gtgatcaccgggtggagcgcactgacatatatcagggatctagcagaggagtatggacta
gcaatacatgggcacagagcaatgcatgcagccttcaccaggaatccataccacggcatc
tcaatgtacgtgctggctaaattatacaggatcataggaatagaccaactacacattggc
acagccggggcaggaaaactcgaaggcgggaagctagacgttataagatacgctaaaata
ctgagagagatacacttcaagccagacccagatgatatgtaccacctagagcaaccaatg
caccacatcaagccggcaatgcctgtctcatcaggtggtttacacccaggcaacctccca
ccagtaatagaggctctgggtacaaacctggtgctacaaataggtggtggggtaataggt
catccagacgggcctagagccggagcactggctgttagacaggcactggaggcaataatg
aataatattccactagacgagtacgctaagacacatagagagctggcaagagcactggag
aaatggggctttgcaaaacccatctag

DBGET integrated database retrieval system