Dokdonella koreensis: I596_1206 Help Entry I596_1206         CDS       T04377                                  Name (GenBank) Putative patch repair protein   KO K07458   DNA mismatch endonuclease, patch repair protein [EC:3.1.-.-] Organism dko  Dokdonella koreensis Brite KEGG Orthology (KO) [BR:dko00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dko03400]     I596_1206 DNA repair and recombination proteins [BR:dko03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      I596_1206 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Vsr Motif Other DBs NCBI-ProteinID:  ANB17236 UniProt:  A0A161HJN5 LinkDB All DBs Position 1425002..1425331 Genome browser AA seq 109 aa AA seqDB search MRDAVRRLSVRFTTDNTDLPGSPDLANRRRHFAIFVHGCFWHRHANCARATTPSSNREFW SNKFKANARRDRRVVRALRRLGFKVMVIWECRTRDPVALTGRIRRFFDS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt gtgcgagatgcagtgcgccgactgagcgtgcgcttcaccaccgacaacaccgatctgcca ggttctccggatctcgccaatcgccgccggcacttcgcgattttcgtgcacggctgcttc tggcatcgtcacgcgaactgcgctcgggctactacgccgtcgagcaatcgcgagttctgg tcgaacaagttcaaggccaacgcgcgaagggacaggcgcgtggtgcgggcgctgcggcgc ctcggattcaaggtcatggtgatctgggagtgtcggacacgagaccctgttgcattgacg ggacggattcggcgatttttcgactcgtga

DBGET integrated database retrieval system