KEGG   Dokdonella koreensis: I596_2492Help
Entry
I596_2492         CDS       T04377                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain CbbS
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dko  Dokdonella koreensis
Pathway
dko00630  Glyoxylate and dicarboxylate metabolism
dko01100  Metabolic pathways
dko01120  Microbial metabolism in diverse environments
dko01200  Carbon metabolism
Module
dko_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:dko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    I596_2492
Enzymes [BR:dko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     I596_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ANB18497
UniProt: A0A160DVD4
LinkDB All DBs
Position
2861995..2862411
Genome map
AA seq 138 aa AA seqDB search
MRITQGTFSFLPDLTDEQIRAQVEYILQQGWAPSIEFTDDPHPRNTYWELWGLPMFDLKD
AAGVLMEVRACRAQYPDHYIKINAFDSTHGFETQRLSFIVNRPQTETGFRLSRQEVDGRN
IRYTLQSYASDRPAGQRF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggcacgttctcgttcctgcccgacctcaccgacgagcagatccgc
gcgcaggtggagtacatcctgcagcaaggctgggcaccgtcgatcgagttcaccgacgac
ccgcacccgcgcaacacctactgggagctgtggggcctgccgatgttcgacctcaaggac
gccgccggcgtgctgatggaggtccgcgcctgccgcgcgcagtacccggaccactacatc
aagatcaatgcgttcgattccacgcacggcttcgagacccagcgcctgtcgttcatcgtc
aaccgcccgcagaccgagaccggcttccgcctgagccgccaggaagtggacggccgcaac
atccgctacacgctgcagtcctacgccagcgaccggcccgccggccagcgcttctga

DBGET integrated database retrieval system