KEGG   Dokdonella koreensis: I596_2920Help
Entry
I596_2920         CDS       T04377                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dko  Dokdonella koreensis
Pathway
dko00620  Pyruvate metabolism
dko00680  Methane metabolism
dko01100  Metabolic pathways
dko01120  Microbial metabolism in diverse environments
dko01200  Carbon metabolism
Module
dko_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I596_2920
  09102 Energy metabolism
   00680 Methane metabolism
    I596_2920
Enzymes [BR:dko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     I596_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DinB_2
Motif
Other DBs
NCBI-ProteinID: ANB18913
UniProt: A0A160DY31
LinkDB All DBs
Position
complement(3348202..3350940)
Genome map
AA seq 912 aa AA seqDB search
MNAIARNAADSLRSIDLPETDQPLRDDVNRVGSLVGEIIAEQEGPAFLDEVERIRIAAIA
RRETGAAAADLQHELADADVAHAAALVRAFSTYFQAVNVAERVHRIRRRRAYEMTDAQPQ
PGGLRHVLRGLKAAGVGAGELAGCLARLRVEPVLTAHPTEAVRRALLEKEHELVRALIAD
IDGNRTPVERRADLERMRLSLTAAWQTAELALEKPTVADELEHVGFYLTDVLYRVVPVFY
EVLADALGEFGPEAAATVLPAVLGFGTWVGGDMDGNPNVGAETIAATLASQRSQVLVLYR
REVLALSSLLSQSLSRVPCSADVLARIDVYRALLPKAAARLKSRQQDMPYRQLLQLVAER
LVESERGREGGYPDAATFVADIALVADSLHAYRGEHAGGFAVRRLLRRAQTFGFHLATLD
LRQDSAVHDAALAALLGDADWTTREAGERVERLGAVLDDPAGVAASADETARRTLAVFRT
VAELRPRYGARAFGPYIVSMSRSAADALAVLALARIAGCLDEAGEVPLDVAPLFETVADL
DAAEDVVRALFADPRYRRHLAARGDRQVVMLGYSDSAKDAGLAASRWALQQTQIALTRLA
REAGIHIVFFHGRGGSASRGGGKTERAVIASPRGSVDGHLRLTEQGEVIHRKYGIRALAL
RNLEQMTGAVLRATLRPRPPEPREPAWRAMAAQVAAEARRVYRGLVHEDPRFPDYFRAAT
PIDVIERLRIGSRPSRRGGSGGIERLRAIPWVFAWAQNRAGLTGWYGVGSGLAQVIAASG
RDAVVEMTRDWPFFAQLVDDVEMVLAKSDLAIFECYSRLAGDLHAPYYARIAEEFDRTRN
AILDLKGETELLSGDLRLRQSIRLRNPYVDPISLLQVDLLARWRAAGCEDDDLLHALIAT
VNGISAGIQNTG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatcgcccgcaacgccgccgacagcctccgctcgatcgacctgcccgaaacc
gaccagcccctgcgcgacgacgtcaaccgcgtcggctccctggtcggcgagatcatcgcc
gagcaggaaggccccgccttcctcgacgaggtcgagcgcatccgcatcgcggccatcgcc
cgccgcgagaccggtgccgccgccgccgatctgcagcacgagctggccgatgccgacgtg
gcccatgccgccgcgctggtgcgcgcgttctcgacctacttccaggccgtcaacgtcgcc
gagcgcgtccaccgcatccgccgccgccgcgcctacgagatgaccgacgcgcagccgcag
cccggcggcctgcgccacgtgctgcgcggcctgaaggcggccggtgtcggtgccggcgag
ctggccggctgcctcgcgcggctgcgcgtggaaccggtgctgaccgcccatccgaccgag
gccgtgcgccgcgccctgctggagaaggagcacgagctggtccgtgccctgatcgccgac
atcgacggcaatcgcacgccggtcgagcggcgcgccgacctcgagcgcatgcgcctgtcg
ctgaccgccgcctggcagaccgccgagctggccctggaaaaacccaccgtcgccgacgag
ctcgaacacgtcggcttctacctgaccgacgtgctgtaccgcgtcgtgccggtgttctac
gaggtgctggccgacgcgctcggcgagttcggtccggaggccgccgccaccgtgttgccg
gccgtgctcggcttcggcacctgggtcggcggcgacatggacggcaatcccaacgtcggc
gccgagaccatcgccgccacgctggccagccagcgcagccaggtgctggtcctgtaccgg
cgcgaagtgctcgccctgtccagcctgttgagccagtcgctgtcgcgcgtgccgtgctcg
gccgacgtgctggcgcgcatcgacgtctaccgcgccctgctgcccaaggccgccgcgcgg
ctgaagtcgcgccagcaggacatgccgtaccggcagctgctgcagctggtggccgagcgc
ctggtcgagtccgagcgcggtcgcgaaggcggctacccggacgcggccaccttcgtcgcc
gacatcgccctggtcgccgacagcctgcacgcgtaccgcggcgagcacgccggcggattc
gcggtgcggcggctgctgcgccgcgcgcagaccttcggtttccacctggccacgctcgac
ctgcgccaggactcggccgtgcacgatgcggcgctcgccgccctgctcggcgacgccgac
tggaccacgcgcgaggccggcgagcgcgtcgagcgcctgggcgccgtcctcgacgatccg
gccggtgtcgccgccagcgccgacgagaccgcccggcgcacgctggccgtgttccgcacg
gtggccgagctgcgtccgcgctacggcgcgcgcgcgttcggcccctacatcgtcagcatg
agccgcagcgccgccgatgcgctggccgtgctggcattggcacgcatcgccggctgcctg
gacgaggccggcgaggtgccgctggacgtcgcgccgctgttcgagaccgtcgccgacctc
gacgccgccgaggacgtcgtgcgcgcgctgttcgccgatccgcgctatcgccgtcacctc
gccgcgcgcggcgaccgccaggtcgtcatgctcggctattcggacagcgccaaggacgcc
ggcctcgccgcctcgcgctgggcgctgcagcagacgcagatcgcgctgacccggctcgcc
cgcgaggccggcatccacatcgtgttcttccacggccgcggcggctcggccagccgcggc
ggcggcaagaccgagcgcgccgtgatcgcctccccgcgcggctcggtcgacggccacctg
cggctgaccgagcagggcgaggtgatccaccgcaagtacggcatccgcgcgctggcactg
cgcaacctggagcagatgaccggcgccgtgctgcgcgccacgctgcgcccgcgcccgccc
gagccgcgcgagccggcctggcgggccatggccgcccaggtcgccgccgaggcgcgccgc
gtctaccgcggcctggtccacgaggatccgcgcttccccgactatttccgcgcggccacg
ccgatcgacgtgatcgagcgcctgcgcatcggctcgcggccgtcccggcgcggcggcagc
ggcggcatcgagcgcctgcgcgcgatcccgtgggtgttcgcctgggcgcagaaccgcgcc
ggtctcaccggttggtacggcgtcggcagcggcctcgcacaggtcatcgccgcgtccggc
cgcgacgccgtcgtcgagatgacgcgcgactggccgttcttcgcgcagctcgtcgacgac
gtggagatggtgctggccaagtcggacctggcgatcttcgagtgctactcgcgcctggcc
ggtgacctgcacgccccgtactacgcgcgcatcgccgaggagttcgaccgcacgcgcaac
gcgatcctcgacctcaagggcgagaccgagctgctctccggcgacctgcgcctgcgccag
tcgatccgcctgcgcaatccctacgtcgacccgatcagtctgctgcaggtggacctgctc
gcgcgctggcgcgccgccggttgcgaggacgacgacctgctgcatgcgctgatcgcgacc
gtcaacgggatctcggcaggtatccagaacaccggttga

DBGET integrated database retrieval system