KEGG   Dokdonella koreensis: I596_2962Help
Entry
I596_2962         CDS       T04377                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dko  Dokdonella koreensis
Pathway
dko00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I596_2962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dko02000]
    I596_2962
Enzymes [BR:dko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I596_2962
Transporters [BR:dko02000]
 Other Transporters
  Pores ion channels [TC:1]
   I596_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ANB18955
UniProt: A0A160DWE1
LinkDB All DBs
Position
complement(3404258..3404929)
Genome map
AA seq 223 aa AA seqDB search
MITVHHLENSRSQRVLWLLEELGLDYAIVRYARDPETLLAPPELRRVHPLGKSPVIVDGA
LTIAESGAIIEYLVDRHGSALAPPAGSPERLRYTYWLHFAEGSAMPPLLLKLVFQRLATA
PMPFFARPVARRIAASVQQRLVDPQLVRQLDYLEGELAGQDWFAGAAFSAADVQMSFPVE
AAAARAGLDAGRPRLWDWLQRIHARPAYRRALERGGPYQLLGE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccaccacctggagaattcgcgctcgcagcgcgtgctgtggctgctcgaa
gagctgggcctggactacgccatcgtgcgctacgcgcgcgacccggaaacgctgctggcg
ccgccggaactgcgccgggtccatccgctcggcaagtcgccggtgatcgtcgacggcgcg
ctgacgatcgccgaatccggcgccatcatcgagtacctggtcgaccgccacggttcggcg
ctggcgccgccggccggctcgcccgagcgcctgcggtacacctactggttgcacttcgcc
gaaggctcggcgatgccgccgctgctgctcaagctggtcttccagcgactggccacggca
ccgatgccgttcttcgcgcggccggtcgcccgccgcattgccgcatcggtgcagcagcgg
ctggtggatccgcagctcgtgcgccaactcgactacctggagggcgagctggccggacag
gactggtttgccggcgccgcgttcagcgccgccgacgtccagatgagttttccggtcgaa
gccgccgcggcgcgcgcgggcctggatgccggccggccgcgcctctgggactggctgcag
cgcatccacgcgcggccggcctatcggcgtgcgctggagcgcggcggcccataccagctg
ctcggcgaatga

DBGET integrated database retrieval system