KEGG   Dokdonella koreensis: I596_338Help
Entry
I596_338          CDS       T04377                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dko  Dokdonella koreensis
Brite
KEGG Orthology (KO) [BR:dko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I596_338
Enzymes [BR:dko01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     I596_338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 DAO HI0933_like Glutaredoxin K_oxygenase Thi4 AlaDh_PNT_C FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ANB16375
UniProt: A0A167GBN1
LinkDB All DBs
Position
423762..425336
Genome map
AA seq 524 aa AA seqDB search
MLDADLKTQLKAYLERVTQPIEIVAALDDSEKSREMQGLLQDIVTLSDKITLVEHRGGER
TPSFAINRPGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKLAQDVIEQVRNLDGEYRF
ETYFSLSCQNCPDVVQALNLMAVLNPKIQHVAIDGALFQDEVDRRQVMSVPTVFLNGETF
AQGRMGVEEIVAKLDTGAVEREARKIAAKPAFDVLVVGGGPAGAAAAIYAARKGIITGVA
AERFGGQVLDTMGIENFISVQETEGPKLAAQLEQHVRQYEVDIMNLQRAEQLVPGELVEV
RLASGASLKSRTVILSTGARWRQMNVPGENEYRNKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGIVSHVTLIEFDSQLRADEVLQRKLRSLPNVTVIVSAQTTEVLGDGQKVT
GLVYKDRPSGDAHTVSLEGIFVQIGLLPNTEWLKGVVDLSPRGEIIVDDRGQTSVPGVYA
AGDCTTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVTDQAKAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccgatctcaaaacccagttgaaggcctacctcgagcgggtcacgcagccg
atcgagatcgtggccgccctcgacgacagcgagaagtcgcgcgagatgcagggcctgctg
caggacatcgtcacgctgtcggacaagatcaccctggtcgagcaccgcggcggcgaacgc
acgccgtccttcgcgatcaaccggcccggcggcgacatcagcctgcgcttcgccggcatc
ccgatgggccatgaattcacctcgctggtgctggccctgctgcaggtgggcggccatccg
tccaagttggcgcaggacgtcatcgagcaggtcaggaacctcgacggcgagtaccgcttc
gagacgtatttttcgctcagctgccagaactgcccggacgtggtccaggcgctcaacctg
atggccgtgctgaacccgaagatccagcatgtggccatcgacggcgcgctgttccaggac
gaggtcgaccgccgccaagtgatgtcggtaccgaccgtgttcctgaacggcgagaccttc
gcgcaagggcgcatgggcgtcgaggagatcgtcgcgaagctcgacaccggcgcggtcgag
cgcgaggcccggaagatcgccgccaagccggccttcgacgtgctcgtcgtcggtggcggc
ccggccggtgccgccgcggcgatctacgccgcgcgcaagggcatcatcaccggtgtcgcc
gccgagcgcttcggcggccaggtgctcgacaccatgggcatcgagaacttcatctccgtg
caggaaaccgaaggccccaagctcgccgcccagctggagcagcacgtgcgccagtacgaa
gtggacatcatgaacctgcagcgcgccgagcagctggtgcccggcgagctggtcgaggtc
aggctggccagcggtgcgtcgctgaagtcgcgcacggtgatcctttccaccggtgcacgc
tggcgccagatgaacgtgcccggtgagaacgagtaccgcaacaagggtgtggcctactgc
ccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcatcggtggcggcaat
tccggcgtcgaggccgcgatcgatctcgccggcatcgtcagccacgtcacgctgatcgag
ttcgacagccagctgcgcgccgacgaggtcctgcagcgcaagctgcgcagcctgcccaac
gtcaccgtgatcgtctccgcgcagaccaccgaagtgctcggcgacggccagaaggtcacc
ggcctggtctacaaggaccgcccgagcggtgacgcgcacacggtctcgctggaaggcatc
ttcgtgcagatcggcctgctgccgaacaccgaatggctcaagggcgtggtggacctctcc
ccgcgcggcgagatcatcgtcgacgaccgcggccagacctcggttcccggcgtctatgcc
gccggcgactgcaccacggtgccgtacaagcagatcgtcatcgcgatgggcgaaggatcc
aaggcggcgctgagcgcgttcgactacctgatccgcagcagcgcgccggtgacggatcag
gcgaaggcggcgtga

DBGET integrated database retrieval system