KEGG   Dokdonella koreensis: I596_3412Help
Entry
I596_3412         CDS       T04377                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dko  Dokdonella koreensis
Brite
KEGG Orthology (KO) [BR:dko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dko01001]
    I596_3412
Enzymes [BR:dko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     I596_3412
Protein kinases [BR:dko01001]
 Serine/threonine kinases: Other
  Bacterial family
   I596_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-ProteinID: ANB19401
UniProt: A0A160DYE0
LinkDB All DBs
Position
3913798..3915807
Genome map
AA seq 669 aa AA seqDB search
MKQRVGHYDIVAELGRGGMGVVYKGFEAALNRYVAIKVLADSLADDPAVRERFLREARSM
AALNDPHIIQIHAIGEDAGHPYFVMEFVEGESLGSLLKREGRLTLEQSLKVIHQTASGLA
TAHDRGVVHRDIKPGNLMVSSRGAIKIADFGIALSNHDLSKKLTTTGEFVGTPGYLSPEV
CLGKPVDRRSDIFSLGIVLFEMLTGKMPFTDESPLGLMLEVVRAEIPDVRQLNANVDEET
SRILSRMIAKDPASRYQDCHELAADLQRNPLVARSGPITLQPKLSPAAATVIGQKTPLPS
AVTTPITAPTPIRPSAGAPTHISAGAAVAPPVPGAPARPSVLDRPTVHASAPKRTSALPW
AIAALLVLAAGAGAWTLRDRIPGLAGPTTTSTQTITATAATADAPASASISSVVTPPIPA
PPPSGPSDPAAGSTPSPADTAAVVPTPDTAAPQAPGATTGAAPPEDTTAGARAQSDPPPA
SPAEPPAPRAAQADVEALRNLPAAQAESGAPPQIAKAPPPPKPAAPAKPRVPTVAVVFGG
DEVIAEPARDAITDLLQSRGFRVIEAGSVSGSQPNLKALSGRADAVVFVQARPVGSQEIH
YYGQSSTLYTVQVAVKAYRVGDGSVLWSSPAEQVNFTTLNAAEKAREVVDPMLDAVDRNL
AEFRPGRRG
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcgcgtgggtcactacgacatcgtcgccgaactcggacgcggcggcatgggc
gtggtctacaagggattcgaggcggcgctgaaccgctacgtcgcgatcaaggtgctggcc
gactcgctggccgacgaccccgccgtgcgcgaacgcttcctgcgcgaagcgcgcagcatg
gcggccctgaacgacccgcacatcatccagatccacgccatcggcgaggacgccggccat
ccgtacttcgtcatggaattcgtcgagggtgagtcgctcggctcgctgctcaagcgcgaa
ggccggctgacgctggagcagtcgctgaaggtcatccaccagaccgcctcgggcctggcg
accgcgcacgaccgcggcgtggtccatcgcgacatcaagccgggcaacctgatggtcagc
agccgcggcgcgatcaagatcgccgacttcggcatcgcgctgtccaaccacgacctgtcc
aagaagctcacgaccaccggcgaattcgtcggcacgcccggctacctgtcgccggaagtg
tgcctcggcaagccggtcgaccggcgctcggacatcttctcgctcggcatcgtgctgttc
gagatgctgaccggcaagatgccgttcaccgacgagtcgccgctggggctgatgctggag
gtcgtgcgggcggaaattcccgacgtgcgccagctcaacgccaatgtcgacgaggagacc
tcgcgcatcctgtcgcggatgatcgccaaggacccggccagccgctaccaggactgccac
gagctggccgccgacctgcagcgcaacccgctggtcgcccgcagcgggccgatcacgctg
cagcccaagctgtcgccggctgccgcgaccgtgatcggccagaagacgccgctgccgtcc
gcggtgacgacgccgatcaccgcgccgacaccgatccggccgtcggcgggcgcgccgacg
cacatcagcgccggcgcggcggtggcgccgccggtgccgggagcgccggcccgtccttcg
gtcctcgaccggccgaccgtgcatgcctccgcgccgaagcgcacgagcgccctgccctgg
gcgatcgccgcgctgctggtgctggccgccggtgccggcgcctggacgctgcgcgaccgg
attcccggcctggccggcccgaccaccacctcgacccagaccatcaccgcgaccgcggcg
accgcggatgcgccggccagcgcgtcgatctcgtcggtcgtcacgccgccgatcccggca
ccgccgccctccggaccgtcggatccggcggccgggagcacgccctcgccggccgatacg
gcagccgtggtcccgacgccggacaccgccgcgccgcaggcgcccggcgccacgaccggc
gcggcaccgcccgaagacacgaccgccggcgcacgggcccagagcgatccgccgccggca
tcaccggccgaaccgccggcgccacgtgccgcacaggccgatgtcgaggccctgcgcaac
ctgccggccgcccaggccgaaagcggcgcgccgccgcagatcgccaaggcgccgccgccc
ccgaagccggccgcgccggcaaagccgcgcgtgccgacggtggcggtggtcttcggcggc
gacgaggtcatcgccgagcccgcccgcgacgccatcaccgacctgctgcagagccggggc
ttccgcgtgatcgaagccggcagcgtctcgggcagccagcccaacctcaaggccctgtcg
ggtcgtgccgatgcggtcgtcttcgtgcaggcccgtccggtcggcagccaggagatccac
tactacggccagagctcgacgctctacaccgtgcaggtggcggtcaaggcgtatcgcgtc
ggcgacggcagcgtgctgtggagcagcccggccgagcaggtcaacttcacgacgctcaac
gccgccgagaaggcccgcgaggtggtcgatccgatgctcgacgccgtcgatcgcaacctg
gccgagttccgtcccgggcgccgtggctga

DBGET integrated database retrieval system