KEGG   Dokdonella koreensis: I596_983Help
Entry
I596_983          CDS       T04377                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
dko  Dokdonella koreensis
Pathway
dko00010  Glycolysis / Gluconeogenesis
dko00620  Pyruvate metabolism
dko01100  Metabolic pathways
dko01110  Biosynthesis of secondary metabolites
dko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I596_983
   00620 Pyruvate metabolism
    I596_983
Enzymes [BR:dko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     I596_983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANB17013
UniProt: A0A160DTR8
LinkDB All DBs
Position
complement(1169069..1170589)
Genome map
AA seq 506 aa AA seqDB search
MTKLELQQLAERPPFKARYGNYIGGQWRAPINGTYFENVTPVTGKPCGEIPRSDKDDIEA
ALDAAHAAKDAWGRTSPAERANILNKIADRIEQNIALLAHAETWDNGKPIRETLNADLPL
AIDHFRYFAGAVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALA
AGNCVVLKPAEQTPASILVLAEVVGDLLPPGVLNIVNGFGVEAGKPLASSPRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVMAEDDDFLDKAIEGFVLFAFNQGEV
CTCPSRALVHEKIYDRFIEKALKRVAAIQLGSPLDPATMVGAQASGEQLQKILSYIDIGR
QEGAEVLIGGEQNVQAGELAGGYYVKPTVFKGHNRMRIFQEEIFGPVLSVTTFKDDAEAL
AIANDTLYGLGAGVWSRDGNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctcgaactccagcaactggccgagcgtccgccgttcaaggcgcgctacggc
aactacatcggcggccagtggcgcgcaccgatcaacggcacctacttcgagaacgtcacg
ccggtcaccggcaagccctgcggcgagatcccgcgctcggacaaggacgacatcgaggcg
gcgctggacgccgcgcatgccgccaaggacgcctggggccgcacctcgccggccgagcgc
gcgaacatcctcaacaagatcgccgaccgcatcgagcagaacatcgcgctgctcgcgcac
gccgagacctgggacaacggcaagccgatccgcgagaccctcaacgccgacctgccgctg
gcgatcgaccatttccgctacttcgccggcgcggtgcgcgcgcaggaaggcggcatcagc
gagatcgaccacgacaccatcgcctaccacttccacgagccgcttggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggcggtgtggaagctggcgccggcgctggcc
gccggcaactgcgtggtactcaagccggccgaacagacaccggccagcatcctggtcctg
gccgaggtcgtcggcgacctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
gtcgaggccggcaagccgctggcgtcgagcccgcgcatcgccaagatcgccttcaccggc
gagacgacgaccggccggctgatcatgcagtacgcctcgcagaacctgatcccggtgacg
ctggagctcggcggcaagtcgccgaacatcttcttcgaggacgtcatggccgaggacgac
gacttcctcgacaaggcgatcgaaggcttcgtgctgttcgcgttcaaccagggcgaggtc
tgcacctgcccgagccgcgcgctggtgcacgagaagatctacgaccgcttcatcgagaag
gcgctcaagcgtgtagcggcgatccagctcggctcgccgctggaccccgcgacgatggtc
ggtgcgcaggcctccggcgagcagctccagaagatcctgtcctacatcgacatcggccgg
caggaaggcgccgaggtgctgatcggcggcgagcagaacgtccaggccggcgagctggcc
ggcggctactacgtcaagccgaccgtcttcaagggccacaaccgcatgcggatcttccag
gaggagatcttcgggccggtgctgtcggtgacgacgttcaaggacgatgccgaggcgctg
gcgatcgccaacgacacgctctacggcctcggtgccggcgtgtggagccgcgacggcaat
cgcgcgtaccggttcggccgcgcgatccaggccgggcgcgtgtggaccaactgctaccac
gcctatccggcgcatgccgcgttcggcggctacaagcaatcgggcatcggccgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctacagcccg
aagaagctcggcttcttctga

DBGET integrated database retrieval system