KEGG   Desulfofundulus kuznetsovii: Desku_0985Help
Entry
Desku_0985        CDS       T01499                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dku00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Desku_0985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dku03400]
    Desku_0985
Enzymes [BR:dku01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Desku_0985
DNA repair and recombination proteins [BR:dku03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Desku_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEG14580
UniProt: F6CIP8
LinkDB All DBs
Position
1012973..1013908
Genome map
AA seq 311 aa AA seqDB search
MDREMIKVFGQNLSFTNLDKLFWPEEGLTKAHLIKYYNDIAPFLLPYIHNRPLVMKRYPD
GISGEAFYQKECPDYAPDWIETFPVHHSERVINYIICNDLATLLWLANQACIEVHAWLST
RDNIECPDIAVMDLDPAQGATFRDILQVALLVREALAEFGLQAFAKTSGARGLHLFIPIR
PVYPFRDVARAMEYIAQLVNRVYPVRTTLERTVPKRKGKVYLDYLQNGRGKTMAFPYSLR
PLPGALVSTPLTWDEVQSLNVNPVDFNINTIFERLKETGDLFRDLLVQEQSLDGILEILA
GPHGLTLGTEG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgggagatgatcaaagtttttggacaaaacctttctttcaccaacctggacaag
ctgttctggcccgaagaaggtttaaccaaggctcatttaataaaatattacaacgatata
gctccctttttgctgccgtatattcataaccgccccctggtcatgaaacgctatcccgac
ggcatcagcggggaagctttttatcagaaggaatgtccggactacgctcccgattggatt
gaaacctttcccgtccaccattcggaaagggtaatcaactacataatctgcaacgatctg
gccactttactctggcttgccaaccaggcctgcattgaagtgcatgcctggctgtctaca
cgggacaatatagagtgtcccgatattgctgtaatggacctggatccggctcaaggcgcc
actttcagggacatcctgcaggttgcccttttggtgcgtgaggccctggcggagtttggc
ctccaggctttcgccaaaacatccggggccaggggtttgcacctgttcatccccatccgg
ccggtatatccattccgggatgtcgccagggccatggagtatatcgcccagctggtcaac
cgggtctatcccgtccggaccaccctggaacgcacagtgcccaaaagaaaggggaaagtc
tacctggactatttgcagaacgggcgcggtaaaaccatggcctttccctacagcctgcgt
cctttgcccggagccctggtttcaacccctctaacctgggatgaggttcagtccctgaac
gtaaacccggtggacttcaacataaacactatttttgagcgcctgaaggaaaccggggat
cttttcagagacctcctggtgcaggaacaaagcctggacggcattctggagatactggcc
gggccccatggattaacgttggggacggaaggttaa

DBGET integrated database retrieval system