KEGG   Desulfotomaculum kuznetsovii: Desku_1293Help
Entry
Desku_1293        CDS       T01499                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00473  D-Alanine metabolism
dku01100  Metabolic pathways
dku01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desku_1293
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Desku_1293
Enzymes [BR:dku01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Desku_1293
Peptidoglycan biosynthesis and degradation proteins [BR:dku01011]
 Precursor biosynthesis
  Racemase
   Desku_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEG14876
UniProt: F6CKT7
LinkDB All DBs
Position
1309448..1310587
Genome map
AA seq 379 aa AA seqDB search
MITESCSNGRPVWVEVNLGAVARNVREIRKLLQPGTKLMAVVKADAYGHGALPVARAALA
NGAECLAVAILDEALALRRGGITAPILILGYTPPEQASFLVEYDLTQTVFSLDAVQAISA
AAAAAGKTARVHIKVDTGMGRIGVFPSEAPDFAEAVSRLPNIFIEGVYTHMACADEQDKA
YTRWQFDRFKEAVAGIEARGVAIPLKHVANSATTLDLPEMHLDMVRTGIILYGLWPSPDV
RRVIDLKPAMQLKTRVAYVKQVPAGTSISYGRTFTTTGPSVIATLPLGYADGWSRLLSNK
AEVLIHGQRAPLVGRVCMDQCMVDVTRIPGVRPGDEVVLFGVQGEQFLPVEEVASHMGTI
NYEMVCLISKRVPRIYLND
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgaaagttgcagtaacggccgtccagtttgggtagaggtaaatctgggggcc
gttgcccgtaacgtgcgggagatccgcaaattgcttcaaccgggtacaaagctgatggcc
gtggtcaaggccgatgcttacggtcacggggcgctgcccgtggcccgggcagccctggcc
aatggcgccgagtgcctggccgtagctattttggatgaagccctggccctgcgccgggga
ggtataaccgcccccatcctgatcctgggttatacccccccggaacaggcgtcctttttg
gtggagtatgatctgacccagaccgttttttccctggatgcagtccaggccatttctgct
gctgccgcagccgcggggaaaaccgcccgggtacacataaaggtggacacgggtatgggc
cgtatcggtgtctttccttctgaggcaccggattttgctgaggccgtatcccggctgccg
aatatctttatcgaaggggtctatacccacatggcctgcgccgacgaacaggacaaagct
tacacccgctggcagttcgaccgctttaaagaagcagtggccggcattgaagcccggggc
gtagccataccgcttaaacacgtggccaacagtgccaccaccctggatttaccggaaatg
catctggatatggtacggacgggtattattttgtacggcctgtggccttctcccgatgtg
cggcgggtaattgatttaaaaccggctatgcagctaaaaacccgggtagcttatgttaaa
caggtgccggctggtacttccatcagctacggccgcacatttaccaccaccggcccttcg
gttattgctactctcccccttggctatgccgacggctggtcccggctgttgtccaataag
gccgaagtgttaattcacgggcagcgggctccgctggtgggccgggtgtgcatggaccag
tgcatggtggacgtaacccggattccgggggtgcggccgggggacgaggtcgttctcttt
ggagtgcagggggagcagtttttacccgttgaggaagtggcctcccatatgggcacaatt
aattatgagatggtttgcttgatcagtaagcgggtaccgcgtatttatcttaatgattga

DBGET integrated database retrieval system