KEGG   Desulfofundulus kuznetsovii: Desku_1322Help
Entry
Desku_1322        CDS       T01499                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dku  Desulfofundulus kuznetsovii
Brite
KEGG Orthology (KO) [BR:dku00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dku01001]
    Desku_1322
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Desku_1322
Protein kinases [BR:dku01001]
 Serine/threonine kinases: Other
  Bacterial family
   Desku_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo RIO1 Pkinase_fungal Kinase-like Haspin_kinase Pox_ser-thr_kin Spuma_A9PTase Seadorna_VP7 PIP49_C
Motif
Other DBs
NCBI-ProteinID: AEG14905
UniProt: F6CKW6
LinkDB All DBs
Position
1340024..1341886
Genome map
AA seq 620 aa AA seqDB search
MIGRQLGNRYEILEQLGGGGMAVVYKGRDTFLNRLVTIKILRPEFSSDKDFTRRFRREAQ
AVASLSHPNIVSIYDVGQEDDIQYLVMEYVDGEDLKTVIRREGALPPEKAVQIAFQVLEA
LEHAHENNIVHRDIKPHNILITKSGRAKLTDFGIAREATAATVTQTDTIVGSVHYLSPEQ
ARGELAGPQSDLYSLGVVLYEMLTGSVPFAGDSPIAVAIKHIQEEPEPPSRRNPAVSPGL
EQVILRAMQKNPQSRFASAREMARHLENLFARDGEEVTRFIPLDEMATRVLKPVEKPRRR
LRPAGWVALTLLLLALLAGGAYALNSYLIGPPPVTVPSVINKELSEAQKILADLGLRVKV
RKEHHPRIPEGFVIDQDIGPADAPVKPPRDITLTVSLGPDLREVPDLYRLSLEDARIRLT
ERGLVLAEQVQKGYDDNVPPDLIFQQSPAAGERVAPNTPVTVYLSLGPKPRQSRVPNLIG
LTLDQARAKLAENNLSLDENVEWVESTDYFQNQVVSQDPAPNGMVEQGTSVKVTLSKGPG
PVPREARVKVPLDNDGQAHQVKIVINDVRGTTLAYVNTHQPGETVLTTVRYYGQATIQVY
VDNKLVKQKSLQEGKNDDDS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgattgggaggcagttgggaaaccggtacgaaatcctggaacaactgggcggcggggga
atggccgttgtttataaaggccgggatactttcttaaaccgcctggttaccattaagatt
ttgcgccccgaattctcctcggataaggactttacccgccgttttcgccgggaagcccag
gcggtggccagcctttcccaccccaacatcgtgtccatttacgatgtggggcaggaagat
gacatccagtacctggtgatggagtatgtggacggggaggacttgaaaaccgtcatccgc
cgggaaggtgccctgcctccggaaaaggcggtgcagattgctttccaggtcctggaggcc
ctggaacacgcccacgagaacaacatcgtgcaccgggatattaaaccccataatatcctg
attacaaagagtgggcgggcaaaactaactgatttcggcattgcccgggaggccacggcg
gcaaccgtcacccagaccgataccattgtagggtcggtacactacctctcgccggagcag
gcccggggggaactggccggcccccagtcggacctctattccctgggcgtggttctttat
gaaatgcttaccggtagcgttccctttgccggggacagtcccattgccgtagccatcaaa
cacatccaggaagaaccggagcccccctcccggcgcaatcctgctgtttcccccgggctt
gagcaggtaatcctgcgggccatgcagaaaaatccccagtcgcgttttgcttccgcccgg
gagatggcccggcacctggaaaatctttttgcccgggacggggaagaggtcacccgtttc
attcccctggatgaaatggccacccgggtgctcaagccggtagagaagccccgtcgcagg
ttgcgtccggcgggatgggtggccctgacccttctcctgcttgcccttttggcagggggc
gcctatgccctgaatagttatcttataggaccgcccccggttacagtgccatcagtaata
aacaaggagttgtccgaggcccagaagatactggctgatttgggattgcgggtgaaagtg
cgcaaggagcatcatcccaggatccccgagggatttgttattgaccaggatattggcccg
gcggatgcgccggtaaagcctccccgggatatcaccctcacggtcagcctgggtcccgac
ctgcgggaagtacccgacctgtaccggctgagtctggaagacgcgcgcatacgcctgact
gaaaggggtttggtcctggccgaacaggtgcagaagggctacgacgataacgttcccccg
gatctgatctttcaacaatctcctgctgccggggaacgggtagctcccaacaccccggtg
acggtttatctttccctgggaccaaagcccaggcagtccagggtgcccaacctcatcggg
ctgaccctggaccaggcccgggccaagctggccgaaaacaacctgagcctggatgaaaat
gtcgagtgggttgagagtaccgattacttccagaatcaggtggtcagccaggatcctgct
cccaacggcatggttgagcagggcacgtccgtaaaggtaaccttgagcaaagggccggga
cccgtgcccagggaggcccgggtgaaggtgccccttgacaacgacgggcaggcccaccag
gttaaaatagtgattaacgatgtccggggaaccactttagcctacgtaaatacccatcaa
ccgggggagacggtattaacgaccgtacgctattacggccaggctactatccaggtgtac
gttgacaataaactggtaaaacaaaaatctcttcaagagggaaaaaatgatgacgatagt
tga

DBGET integrated database retrieval system