KEGG   Desulfofundulus kuznetsovii: Desku_2001Help
Entry
Desku_2001        CDS       T01499                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dku00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Desku_2001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dku02000]
    Desku_2001
Transporters [BR:dku02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Desku_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_22 Mg_chelatase NACHT Pox_A32
Motif
Other DBs
NCBI-ProteinID: AEG15557
UniProt: F6CJQ1
LinkDB All DBs
Position
complement(1986620..1987549)
Genome map
AA seq 309 aa AA seqDB search
MPLLLIKNLTVDFPLPEGTVHVLDDVSLELGEKERLALIGETGSGKTVLGHAILRLLPPG
TQVRGEVWYDGCNLLSLPSTRMREFRGKEIAMVLQNPAAALNPVLTGGYQVREAIAHRWH
LNGRPVRRKVAELLARVRLPERVISSYPHQFSGGMQQRLLLSLGLALEPRLLIADEPTKG
LDWPLRAQVVELLREMTFGQRAFILITHDLPAARQLADRVAVLYAGQVVEYGPAEAVFSA
PRHPYTSGLLDSHPARGLKPIPGAAPAFTALPPGCRFQPRCCRARAICAREVPPLAEVAP
GYRVRCYCC
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgctattgatcaaaaacctgacggttgattttccgcttccggaaggaacggta
cacgttctcgacgatgtcagcctggaactgggggagaaggaaaggctggcgctcattggg
gaaaccggttcgggcaaaaccgtattaggacacgccattctacgccttctgccgcccggg
acgcaagtgcggggcgaggtctggtatgacgggtgtaaccttttatctcttccatccacc
cggatgcgggagttcagggggaaagagattgccatggttctacaaaaccccgccgcggcg
ttaaaccccgtcctcactgggggatatcaggtgagagaggcgattgcccaccggtggcac
ctgaacgggcgcccagtccgccggaaggtagcggaactcctggcgagggttagactgccc
gagcgggtcatatccagctacccccaccagttcagcgggggtatgcagcagcgattgctc
ctgtctctcggcctggcgctggagccccgtcttttgatcgccgacgaaccaaccaagggg
cttgattggcccctgagggcgcaggtggtggagcttctccgggagatgacgttcgggcag
cgcgcgtttattctaatcacccacgatctgcctgccgcgcggcagctggctgacagggtc
gccgtgctatacgcgggccaggtggtggaatacggcccggcggaggccgttttttccgcg
ccgcgtcatccttataccagcggccttcttgactcccacccggcccgggggctgaaaccg
attccgggggcggcgcctgccttcaccgcgcttcctccgggttgccggtttcagccgcgg
tgctgccgggccagggcgatttgcgcgcgggaggtaccgccgctggccgaggtggccccg
gggtacagggtgaggtgttattgttgttag

DBGET integrated database retrieval system