KEGG   Desulfofundulus kuznetsovii: Desku_2522Help
Entry
Desku_2522        CDS       T01499                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
dku  Desulfofundulus kuznetsovii
Brite
Transporters [BR:dku02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    Desku_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF3894
Motif
Other DBs
NCBI-ProteinID: AEG16047
UniProt: F6CM79
LinkDB All DBs
Position
complement(2505019..2506455)
Genome map
AA seq 478 aa AA seqDB search
MTGVARKEEINLLTRLDRIPVTRSTILIMALLALTWVIEAFDIGIVGQTVLVLKKLWNLT
PGDVGLLGTSSTLGIVIGVYFAGRLIDKFGRKKVLVYGVAWFAFFTGIGALIPNLYWVVI
MRFIAGLGEGAVFPIPYLLISEFVGAKWRGTVVSWQNAILCAAYVLPSIVGAWALSQFPL
DVAWRIPFIAGGLPILYVIVLALCLPESPRWLLQQGRIDEVRKLVNRLEDEAGLEHDENL
INPGILRSLQNQQTEKKQVGVASIFKQPYLSRSLVSWGLYTGSMICWYAMLVYAPTIFAT
RGFAMENAILFTGAMMVIGGIGEVAIGYLSDVYGRKPVYFIYSILAAVGMVMLAQFSSLA
GLIIGGFIAAFFGFGTLPSAKIYIAEQYPTHLRGVGTGVGEAVARLLGGVLAAYYIPFIL
NAGGVKAVFWFVAAAFIVFVIPLMIWGQETARRSVEETGSTLSGEQIKAQFSIEDAKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgttgccagaaaagaagagattaatctcctgacgcgattggatcggattccg
gttaccaggagtaccattctgatcatggctctgctggccctaacctgggtcattgaagcc
tttgatatcggcattgtgggtcaaacggtgcttgtcttaaagaagctttggaacctgact
ccgggcgatgttggcctgctaggtacgtcttccaccttgggcatagttatcggtgtttat
tttgccggtcggctgattgataaattcggccgcaagaaagttcttgtctatggtgtagcc
tggtttgccttttttaccggcattggtgctttaattcccaacctgtactgggtagttatc
atgcgttttattgctggcctgggcgagggtgcagttttccccattccttacctgctaatt
tccgagtttgtaggtgccaaatggcggggtacggtggttagctggcagaacgccatcctt
tgtgcggcctacgtactgcccagtattgtcggtgcctgggctctgtctcaattccccctg
gatgtggcctggcggattcctttcattgctggtggactgcccatactctacgttatagta
ttggccttgtgtcttccggaatcaccgcgctggttgctacaacagggacgaatagatgag
gtacgaaagctggtaaatcgcctggaagatgaagcaggcctggaacacgatgagaatttg
atcaaccccggcattctcagatctttgcaaaaccagcagaccgagaaaaaacaggtgggg
gttgcctcaatcttcaaacagccctacctgtcccgaagcctcgtttcctgggggctatat
accggttccatgatctgctggtacgccatgctggtttatgcgccgaccatctttgccacc
agggggtttgccatggaaaacgccatcctcttcaccggggcaatgatggttattggcggt
atcggtgaagtggcaatcggctacctctccgatgtttacggccgcaaaccggtctacttc
atctatagtattctggcagctgtagggatggtgatgctggcacagttttccagcctggcg
gggttaataattggtggttttatcgcggctttcttcggctttggcaccctgccgtcggcc
aaaatctatattgccgagcaataccccactcacctgcggggagtagggaccggagtgggt
gaagccgtggccaggctcctgggcggggttctggcagcttactatattcctttcatcctc
aacgctggcggggtgaaagcggtgttctggtttgtggcggctgcctttatagtgtttgtg
atcccgctcatgatttgggggcaggaaactgcccgccgcagcgtagaggaaaccggttcc
actctgagcggtgaacagataaaggctcagttttctattgaagatgcaaaattataa

DBGET integrated database retrieval system