KEGG   Desulfofundulus kuznetsovii: Desku_2692Help
Entry
Desku_2692        CDS       T01499                                 

Definition
(GenBank) Thioredoxin-disulfide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dku  Desulfofundulus kuznetsovii
Brite
KEGG Orthology (KO) [BR:dku00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Desku_2692
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Desku_2692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 FAD_oxidored Pyr_redox Thi4 HI0933_like Lycopene_cycl NAD_binding_9 GIDA K_oxygenase NAD_binding_8 DAO NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AEG16215
LinkDB All DBs
Position
complement(2675746..2676654)
Genome map
AA seq 302 aa AA seqDB search
MYDLVIIGMGPAGLTAAVYAARKKLSTLLVGKQYGGQMAWASGVENYIGFQYITGPELLS
KFEDHVKQYPVERVEAEVVKLTRENGHFITRTAGGEEFHSRAVIVASGKAPRRLNAPGER
ELTGRGVSYCAVCDAPLFAGMDVAVVGGGNSALTAAYDLIKIAKQVYVVSLAEWTADPII
VDKVKDAPNLTKLVGYETVRIEGNERVTGITLRSLDGRKEEKKIPVQGVFIEIGTVPSTH
FVEGLLELNEKGEIKVDCDCSTSVPGAFAAGDVSSIPEKQIIVAAGEGAKAALGAYRYLL
NQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacctggtcattatcgggatgggcccggcagggttaacggcggccgtatatgcg
gcccgcaaaaagctgtctaccctcttagttggaaaacagtatggaggccagatggcctgg
gcttcgggagtagaaaactatatcggttttcaatacattaccggtcccgaattgctgtct
aagtttgaagaccatgtaaaacaataccccgttgagcgggtcgaagccgaagtggttaaa
ctaacccgggagaacggtcattttatcacccgcactgccggcggcgaggagtttcactcg
cgggcggtgattgtagcttccggcaaggctccccgccggctcaatgcgcccggtgaaagg
gagttgacgggccggggggtcagctactgcgcggtttgcgatgcccccctttttgccggt
atggacgtggctgtggtgggcggcggcaactcggcccttacggcggcttacgatttgatc
aaaatagccaaacaggtctacgttgtctccctggcggaatggacggcggaccccattatc
gtcgacaaagtgaaagatgcgccgaatctgaccaagctggtggggtacgaaacggtgcgc
atcgaaggaaacgaaagggtgacgggcatcactttgcgctccctggacgggcgaaaagaa
gagaaaaaaatacccgtgcaaggggtatttatcgaaattggcaccgtacccagcacacat
tttgtcgaaggtctgctggagctgaacgagaagggggagatcaaggtcgactgcgactgc
agcacctccgtacccggtgcctttgcagccggggatgtgagcagcattccggaaaaacag
attattgttgccgccggggaaggggccaaggccgccctgggggcctaccgttatttgctc
aatcaatag

DBGET integrated database retrieval system