KEGG   Desulfofundulus kuznetsovii: Desku_3098Help
Entry
Desku_3098        CDS       T01499                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00473  D-Alanine metabolism
dku00550  Peptidoglycan biosynthesis
dku01100  Metabolic pathways
dku01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desku_3098
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desku_3098
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Desku_3098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dku01011]
    Desku_3098
Enzymes [BR:dku01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Desku_3098
Peptidoglycan biosynthesis and degradation proteins [BR:dku01011]
 Precursor biosynthesis
  Amino acid ligase
   Desku_3098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A DUF2778
Motif
Other DBs
NCBI-ProteinID: AEG16593
UniProt: F6CLH5
LinkDB All DBs
Position
complement(3110669..3111787)
Genome map
AA seq 372 aa AA seqDB search
MAKKRVAVIFGGRSGEHQVSLNSAASVIGALDKDRYEIIPVAITPEGKWFAGIEPAQLLA
GEDPEQLGQRVALLADPTYGGLAPVGDGCIRVEQLRPIDVAIPVLHGTFGEDGTVQGLLE
LANIPYVGAGVMASAVGMDKVMMKTVFARHGLPQVRFCHFLRREWERDPEAVLDRVEQLG
YPVFVKPANLGSSVGISKARNREELRRAIDLAASYDRKIIVEEFADVREVEVSVLGNDDP
VASLPGEIIPLNEFYDYEAKYVEGKSRLVIPARLPGQTMLELQRLAICAFKALDCAGLAR
VDFFLRRDNGAVLINEINTIPGFTRTSMYPKLWEATGIPYQDLLDRLIELALERHREKNR
SRTTFRPPGAAG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaacgggtggcggtcatttttggcgggcgttcgggagagcaccaggtctcc
ttaaactcggcggcttcggtgattggcgccctggataaggacaggtacgagattattccc
gtggccattactccggaaggaaaatggttcgcaggcattgagccggcacaattgctggcc
ggggaggacccggagcaactgggacaaagggtcgctctgctggcggaccccacttatggg
gggctggctcctgtgggggacgggtgcataagggtggaacagttgcgtcctatcgacgtg
gctatcccggtactgcacggcacctttggcgaggatggtaccgtccaggggcttctggaa
ctggccaacattccctatgtaggggcgggggtgatggcttcggcagtgggcatggataaa
gtaatgatgaagaccgtctttgcccggcacggcctgccccaggtgcgtttctgccacttc
ctgcgccgtgagtgggagcgggacccggaggcggtgctggaccgggtggaacagctgggt
tatcccgtctttgtcaagccggccaacctcggttccagcgtgggcatatccaaggcgagg
aaccgggaggaactacggcgggccatagacctggccgccagctacgatcgcaagattatc
gtggaggagtttgcggatgtccgggaagtggaggtaagcgttctggggaacgatgatccg
gtggcttccctgccgggggaaattattccattgaatgaattttacgattacgaggccaaa
tacgtggagggaaaatcccggctggttataccggcccggttgccgggacaaaccatgctg
gagttgcaaagattggccatttgcgcctttaaggccctggactgtgccggtttggcccgg
gtggattttttcctgcgccgggataacggggccgtgctgatcaacgaaatcaacaccatc
cccggcttcacccgcaccagcatgtatcccaagttgtgggaagctaccggcatcccttat
caggatttgctggaccggcttattgagctggccctggaaaggcaccgggaaaagaaccgg
tcccggaccaccttccggccgccgggggccgccggttaa

DBGET integrated database retrieval system