KEGG   Desulfofundulus kuznetsovii: Desku_3121Help
Entry
Desku_3121        CDS       T01499                                 

Definition
(GenBank) L-aspartate oxidase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00020  Citrate cycle (TCA cycle)
dku00190  Oxidative phosphorylation
dku00650  Butanoate metabolism
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01120  Microbial metabolism in diverse environments
dku01130  Biosynthesis of antibiotics
dku01200  Carbon metabolism
Module
dku_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dku_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desku_3121
   00650 Butanoate metabolism
    Desku_3121
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Desku_3121
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Desku_3121
    1.3.5.4  fumarate reductase (quinol)
     Desku_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_oxidored DAO HI0933_like GIDA FAD_binding_3 PolyG_pol SspN MinE
Motif
Other DBs
NCBI-ProteinID: AEG16615
UniProt: F6CM99
LinkDB All DBs
Position
complement(3133823..3135448)
Genome map
AA seq 541 aa AA seqDB search
MGYPIEMQESIRKLEATRAFRLQQEIPRLTPEEKTRLLEQCHPDFRPDGMRPVRVGPNKG
QRMQNELVDLLEAYSRIDPDRVDLSRIDYDVDVLVVGGGGGGATAALIAHENGARVLLTT
KLRLGDANTMMAEGGIAAATQPNDSPYLHFLDTIGGGRFQNKRELVWALVHDAPLIVEWL
KDLGAMFDTHPNGDLVVSFAGGHCRRRVHSCKDLSGMEFMRVIRDELWNRRVEVLEFSPA
VELLLDERGRCAGAILMNLETREHIIVRAKAVILATGGIGRLHPNKFPTTNHYGATADGL
VIAYRAGARLLHMDAIQYHPTGAAWPEQMLGQLITEALRGNGAQLVNVHGERFINELETR
DVTSSAIIREVRDRKNGVRTPTGMEGVWLDTPLIDIRGGEGKLDRMFAGIVHRFREYGID
VHKEPILVFPTQHYQNGGIEIDPEGRTDIPGLFAAGEVAGGVQGRNRLGGNSLVDIFVFG
RRAGQAAALFAREGPSPGKLTLEHVRRYHRELAAEGIEKGRVSPLLLPDYTRPEVKERRY
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgggctatcccatagaaatgcaggaatcaattcgcaaactggaagctacccgtgccttt
cgcctccagcaggaaattccgcgcctgacgccggaagagaaaacccgcctgctcgagcaa
tgccaccccgacttccgtccggatgggatgcggccggtaagggtgggtcccaataaaggc
cagcgcatgcaaaatgaactggtggatctcctggaggcctacagccgtattgacccggat
cgtgtggacctcagccgtatagattacgatgtggatgtcctggtggtgggcgggggtggc
gggggagcaactgccgccctcattgcccacgaaaatggagcgcgggtgctcctgaccacc
aagctgaggttgggcgatgccaataccatgatggcggaaggaggtattgccgccgccacc
cagcccaatgactctccctatttgcattttctggataccattggcggaggaaggttccag
aataagcgggagctggtctgggcgctggtacacgatgcgcccctgatcgtggaatggctg
aaggacctgggggccatgtttgatacccacccgaacggggatctggtggtatcctttgcc
ggggggcactgccgccgccgggtgcactcctgcaaggacttaagcggtatggaatttatg
cgggtcattcgcgatgagctgtggaacagaagggtggaggtgctggaattcagtcccgcg
gtggaacttttgctggacgaaagaggccgctgtgcgggggccattttgatgaacctggag
acccgcgagcacatcattgtccgggctaaagcggttatcctggctaccggcggcattggc
cgcctgcaccccaataaattccctaccacgaaccactacggtgccactgccgacgggctg
gtgattgcttaccgggccggagcccgccttttgcacatggacgccattcagtaccaccct
accggtgccgcctggccggagcagatgttgggccagctgatcaccgaggccctgcggggc
aacggtgcccagctggtgaacgtacacggggaaaggtttatcaacgaactggaaacccgc
gacgtaacctcttcggcgatcatccgggaagtgcgggacaggaaaaatggggtacgcaca
cctacgggcatggagggggtgtggctggatacacctctaattgatatccgcggtggagaa
ggaaaactggaccggatgtttgccggcatagtgcaccggtttcgcgaatatggtatcgac
gtccacaaagagcccatccttgtctttccaactcagcattaccagaatggtggcatcgag
atcgatccggaagggagaacagatatacccggcctttttgcggccggcgaggtggcggga
ggggtgcagggcaggaaccgcctgggcgggaactccctggtggacatttttgtctttggc
cggcgggccggacaggcagcggcgctttttgccagggagggtccttcacctggaaagctt
acgctggaacacgtgcgccgttatcatcgggaactggctgccgaaggcattgaaaagggg
cgcgtctcaccgctgttgcttcccgattatacccgtcccgaagtcaaagagcgtcgctat
agttaa

DBGET integrated database retrieval system