KEGG   Desulfofundulus kuznetsovii: Desku_3351Help
Entry
Desku_3351        CDS       T01499                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00564  Glycerophospholipid metabolism
dku01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Desku_3351
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Desku_3351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Fer2_BFD Pyr_redox_2 FAD_binding_2 FAD_oxidored NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEG16835
UniProt: F6CNT2
LinkDB All DBs
Position
complement(3378878..3380491)
Genome map
AA seq 537 aa AA seqDB search
MIKRERAQVAVVGGGATGVGVLRDLAMRGVDVVLVEQFDLGHGTSSRFHGLLHSGARYAV
KDMDAAVECIRENEILKQIAPACVEDTGGLFVHLDGEDPDYVGRWVSACRAAGIDVQEVD
VQDLRARYPGLSPRVRRAFRVPDGAVDGFRLLRANVRSARRHGARVFTYHRVTGVHIADG
RVTGVELTNTLTGEKSHLECQVLVNAAGPWAGKVAELAGLKVSVLHDKGTLAVFNHRFVN
QVINRLRPPGDGDIFVPHNTVTILGTTSQEVAGPAFARPAAEEVQQLLATGEEVFPGLRR
YRLIRAFAGVRPLYRSGTAQAGREVSRNFVLLDHREDGLNGMVSIVGGKLTTYRLMAEKT
ADLVCSLLCINSPCRTAQEPLTEPIPPADLNRGRRLFGFPAAVKAAERWGSEFKDILQKA
GADPSKAELICECELVSRAEIEHAAGCADTFTLCDIRRKTRMGMGTCQGAFCAFRTLGVA
AEHNTCVLENNLHYLREFLQSRWEGIRPVLWGQQLRETQLAQAIYGTIFNLERMCRS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaagggaacgcgcccaggtggcggttgtcggcgggggggccacaggtgttggc
gtcttgagggacctggccatgcgcggtgttgatgttgtgcttgtggaacagttcgacctg
ggtcacggtaccagctcccgtttccacggccttttgcacagcggggcacgctacgcggtc
aaggacatggacgccgccgtggaatgcatccgggaaaatgaaattctgaagcagattgcg
cccgcctgcgtggaggacaccggcggcctgtttgtgcacctggacggtgaagatccggat
tatgtgggccggtgggtatccgcctgccgggcggccggcatcgatgttcaggaagtggat
gtacaggacttgcgcgcccggtatcctggcctttccccgcgggtcaggcgggccttcagg
gttcccgatggtgccgtagacggctttcgcctgctccgggccaacgtgcgctcggcacgg
cgccacggggcgcgcgtgttcacttaccaccgggtgaccggggtgcacattgccgacggt
cgggtgacgggcgtggaactgaccaatactctaaccggtgaaaaatcccacctggaatgc
caggtgctggttaacgccgccgggccctgggccggaaaggtggcggaactggcgggactc
aaagtaagcgtcttgcatgataaaggtaccctcgccgtttttaaccaccgtttcgtcaac
caggtaattaacaggctccgcccgccgggggacggcgacatattcgtgcctcacaacacg
gtaaccattttgggcaccacttcccaggaggtggccgggcccgcgttcgccaggccggcg
gcggaggaggtgcagcagctcctggccacaggtgaggaggtatttcccggtttgcgccgg
taccgcctgatccgggcctttgccggcgtccgcccactttaccgcagcgggaccgcccag
gcgggccgggaggtatcgcggaattttgtcctgctagaccaccgggaggacggtttaaac
ggcatggtcagcattgtgggcggcaagctgaccacttaccggttgatggcagaaaaaacg
gccgacctggtttgctccctgctatgcatcaacagcccgtgccgcacggcgcaggaacct
ttaacggaacccatccctccggcggacttaaaccggggcaggcggttgttcgggtttccc
gcagcggtcaaggccgcagagcgctggggtagcgaatttaaagacattttgcaaaaggcc
ggggccgaccccagcaaggcggagctcatctgtgagtgcgagcttgtcagccgggcggaa
atagaacacgcggccggctgtgccgacacctttaccttgtgcgacatccgtcggaagacc
aggatgggcatgggcacctgccagggcgccttttgcgccttccgtaccctgggggtggct
gcggagcataacacttgcgtgctggaaaacaaccttcactacctgcgcgaattcctgcag
agccggtgggagggcatccgcccggtgttgtgggggcagcaattgcgggaaacccagctt
gcccaggccatttacggcaccatatttaaccttgaaaggatgtgccggtcatga

DBGET integrated database retrieval system