KEGG   Delphinapterus leucas (beluga whale): 111162642Help
Entry
111162642         CDS       T05885                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00053  Ascorbate and aldarate metabolism
dle00071  Fatty acid degradation
dle00280  Valine, leucine and isoleucine degradation
dle00310  Lysine degradation
dle00330  Arginine and proline metabolism
dle00340  Histidine metabolism
dle00380  Tryptophan metabolism
dle00410  beta-Alanine metabolism
dle00561  Glycerolipid metabolism
dle00620  Pyruvate metabolism
dle01100  Metabolic pathways
Module
dle_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111162642
   00053 Ascorbate and aldarate metabolism
    111162642
   00620 Pyruvate metabolism
    111162642
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111162642
   00561 Glycerolipid metabolism
    111162642
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111162642
   00310 Lysine degradation
    111162642
   00330 Arginine and proline metabolism
    111162642
   00340 Histidine metabolism
    111162642
   00380 Tryptophan metabolism
    111162642
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111162642
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111162642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111162642
NCBI-ProteinID: XP_022406389
UniProt: A0A2Y9LAA7
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MLRAVVLAAARPCQGRRLLSAAATPAVPAPNQQPEVFYNKIFINNEWHDSVSKKTFPTIN
PSTGDVICHVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASKRGWLLNRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNII
PGFGPTAGAAVASHEDVDKVAFTGSTEVGHLIQTAAGNSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYTEFVERSVARARSRVVGNPFDSRTEQ
GPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGA
QSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgcagttgtgctcgccgccgcccggccctgccagggccgccggctgctgtcg
gccgccgccaccccggccgtgccggcccccaaccagcagcccgaggtcttctacaacaag
atcttcataaacaacgagtggcatgattctgtcagcaagaaaactttccccaccatcaat
ccatccactggggatgtcatctgtcacgtagctgaaggggacaaggaagacgtggacagg
gcagtgaaggctgcccgggctgcattccagctgggctctccctggcgccgcatggatgcg
tccaaaaggggctggctgctgaaccgcctggctgatctgattgagcgggaccggacctac
ctagcagccttggagaccctggacaacggcaagccctacgtcatttcctacctggtggat
ttggacatggttctcaaatgtctccgttactatgcaggctgggctgataagtaccatgga
aaaaccattcccatcgatggggactacttcagctacacccgccatgaacctgtgggagtg
tgcgggcagatcatcccgtggaacttcccgctcttgatgcaagcatggaaactgggacca
gccttggcgactggaaacgtggttgtgatgaaggtggctgagcagactccactcactgcc
ctctatgtggccaacttgattaaggaggccggctttcctcctggcgtggtcaatatcata
cctggatttggccccacagctggggctgccgttgcctctcatgaggatgtggacaaagtg
gccttcacaggctccactgaggttggccacctaatccagactgctgcggggaacagtaac
ctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagatgct
gacatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggccagtgc
tgctgtgcaggctcccggacctttgtgcaggaggacgtttacaccgagtttgtggagcgg
agtgttgcccgggccaggtctcgtgtggtcgggaacccctttgacagccggactgagcag
gggccgcaggtggatgagactcagtttaagaaggtccttggctacatcaaatctgggaag
gaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttcatc
cagcccaccgtgtttggagacgtgcaggatggcatgaccatcgcaaaggaggagatcttt
gggccagtgatgcagattctgaagttcaagaccatagaggaagtcgttgggagagccaac
aattccaagtacgggctggccgcagctgtcttcacaaaggacttggacaaggccaattat
ctgtcccaagccctccaggctggcaccgtgtgggtcaactgctatgatgtgtttggggcc
cagtcaccgtttggtggctacaagctgtctgggagcggccgggagctgggagagtatggg
ctgcaggcatacactgaagtgaaaactgtcacagtcaaagttcctcagaagaactcataa

DBGET integrated database retrieval system