KEGG   Delphinapterus leucas (beluga whale): 111162647
Entry
111162647         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 2'-5'-oligoadenylate synthase 2-like
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04621  NOD-like receptor signaling pathway
dle05160  Hepatitis C
dle05162  Measles
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111162647
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    111162647
   05171 Coronavirus disease - COVID-19
    111162647
   05164 Influenza A
    111162647
   05162 Measles
    111162647
   05168 Herpes simplex virus 1 infection
    111162647
   05169 Epstein-Barr virus infection
    111162647
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     111162647
SSDB
Motif
Pfam: OAS1_C SMODS NTP_transf_2 SapB_1
Other DBs
NCBI-GeneID: 111162647
NCBI-ProteinID: XP_030620131
LinkDB
Position
Unknown
AA seq 1117 aa
MKKLRKTRANQLDKFIEDRLLPDEDFRAQVSEAIHTICSFLKERCFRGAPHPQLRVSKVV
QGGSSGKGTTLRGRSDADLVIFLTNLKSFQEQLQRRGEFIKEIRRQLEACQREEIFEVEF
EKQQWESPRALSFVLRSCQLHECVEFDVLPAFDALGQLTKGYRPDPQVYVQLIQECEFLG
REGEFSPCFTELQRAFLRDRPTKLKSLIRLVKHWYQMCKEKLGKPLPPQYALELLTVYAW
EQGSMETRFNTAQGFQTVLELVLKHQKLCIYWKNYYNFENPIIGQYLRKQLEKPRPVILD
PADPTGNVGGGDPLSWQRLAQEARAWLSYPCLKKWDGSPVGSWDVSPQDHSDLMCEDYGF
RQSYRTSPRPTLQGGAPPQVEENWTCAILLSSQQPARAMGNWESHLYERPAQKLGEFTQD
NLRPFEDCQKQIDQTVDTICAVLQEAEXFPLVTGVAKSGSYGRRMVLRGNSNGTLVIFIG
SLEQFQDQKKSQHDLLWAQLKRCELTMKLXSQVEIQSISGKLTIQLSTEQQSITFEMLPA
FNALGLSEKPSLCTYRELKRSLDMVKASPGEFSICFTELQEKFFSNHPSKLKDLILLVKY
WCQKCQEKLKDSSLLPLYALELLTVYAWEQGCGAEDFDITXGIRTVLELIRKQEQLCVYW
TVNYNFEDKTVRNILLGHLRSPRPVILDPTDPTSNVSKDNTCWQLLKQEAQTWLSSLRLN
ESPGLSWNVLPAPLYVTPGHLLDKFIKDFLQPNRTFLDQIKKAVDIVCKFLKENCFRHST
TKCQKIVKGWSTAKGTALKSSSHADLVVFADPLKSYTSQKNERCNIIKEIHKQLEACQQE
KDFEVKFEISKWKAPRVLSLTLKSKVLNESVDFDVLPAFNALGELKSVSTPSPRIYADLI
YLPKSSDALGGEFSTCFTELQRNFVCSRPTKLKDLIRLTGTNGTVHTAKAQQRSLRGLPL
SCKLTLPRPVPALRLETWVPYSGPSSPSRAPSKALATLISPSCFSQYRLMFPLFPQCGSK
LKQKGPLPPKYALELLTIYAWEQGSGAQDFDTAEGFRTVLELITNEQHLCVLWMVNYNFD
DEIVRSFLLTQIQRTGCPKPQPPPFLNLIPSNAILVT
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgaagaagcttagaaagacccgagccaaccaactggacaagttcatcgaagaccgcctc
ctgccagacgaggatttccgcgcgcaggtcagtgaagccatccacaccatctgcagcttc
ctgaaggagaggtgtttccggggggccccccacccccaacttcgggtgtccaaagtcgtg
cagggtggctcctcaggcaaaggcacaaccctcaggggccgatcagatgctgacctcgtc
atcttcctcaccaatcttaaaagttttcaggaacaacttcagcgccgaggagaattcatc
aaggaaattaggagacagctggaagcctgtcaaagggaggaaatatttgaagtggagttt
gagaaacagcaatgggagagtccccgtgctctcagcttcgtgcttagatcctgtcagctc
catgagtgcgtggagtttgatgtcctgcccgcttttgatgccctgggtcagttgaccaaa
ggctacagacctgaccctcaagtctacgtccagcttatccaagagtgcgagttcctgggg
agagagggcgagttctccccctgcttcacggagctgcagcgagccttcctgagggaccgt
ccaaccaaactgaagagcctcatccgccttgtgaagcactggtaccaaatgtgtaaggag
aagcttgggaagccgctgcccccacagtatgccctggagcttctgacagtctatgcttgg
gagcaaggaagcatggaaacaagattcaacacagctcagggatttcagaccgtcttagaa
ttagtcctgaagcatcagaagctttgcatctactggaaaaactattacaactttgaaaac
cctattattggacaatacctgagaaagcaacttgaaaaacccaggcctgtgattctggac
ccggctgaccctacaggaaacgttggtggtggagacccacttagctggcagcggctggca
caagaggctagagcctggctgagttacccatgcttaaagaaatgggacgggtctccagta
ggctcctgggatgtgtcgccccaagaccatagtgacctgatgtgcgaggactatggtttt
agacagagctatagaacctctccgagacccacactccagggaggagcccctccccaggtg
gaagagaactggacatgtgccatcctcctgtcatctcagcagccagccagagcaatggga
aactgggagtcccatctctacgaacggcctgcccagaaactgggtgagtttacccaggac
aacctgaggccctttgaagactgtcagaaacagatcgaccagaccgtggacaccatctgt
gcagtcctgcaggaagctgagtagttccccctggtgaccggcgtggccaaaagtggctcc
tatggccggagaatggtcttgaggggcaactccaatggcaccctcgtcatcttcatcggt
agccttgaacaattccaggatcagaaaaaaagccaacatgacctcctctgggcacagttg
aaacgctgtgagctcacgatgaagctgngcagccaagtggagatccagagcatcagtggc
aagctcaccatccagctgtccacagaacagcagagcatcactttcgagatgctgcccgcc
ttcaacgctctgggcttaagtgagaagcccagcctctgcacctatcgagagctcaaaaga
tccttggatatggtgaaagccagccccggtgagttctcaatctgcttcactgaactccag
gagaagttttttagcaaccatcccagcaagctgaaggatttgatcctcttggtaaagtac
tggtgtcaaaagtgccaggaaaagctgaaggattcatccctgctgcccctgtatgcgctg
gagctgcttacggtctatgcctgggaacaggggtgtggagcagaagactttgacataact
ngaggcatcaggactgttctggagcttatcaggaagcaggagcagctatgtgtctactgg
acagtcaactacaactttgaagataagaccgtccgcaacatcctgctgggccacctccga
tccccgaggccagtaatcttggatccaactgacccaaccagtaatgtgagcaaagataac
acctgctggcagctgctaaaacaagaagctcaaacctggttatcttctctcaggctgaac
gagtcacctggactgtcctggaatgttctgcctgcgccgctctacgtgaccccaggccat
cttctagacaagttcatcaaggactttctccagcccaacaggactttcctagatcagatc
aagaaagctgttgacatcgtctgtaagtttcttaaagagaattgctttcgacattcaact
acaaagtgtcagaagattgtcaagggctggtcaaccgccaaaggcacggctctgaagagc
agttcccatgccgaccttgttgtgttcgcggacccgctgaaaagctacacctcccagaaa
aacgagagatgcaacatcatcaaggaaatccataagcaactggaagcctgtcagcaggag
aaggattttgaagtgaagtttgagatttcaaaatggaaggctccccgggtgctgagctta
actctgaaatccaaagtcctcaacgaaagtgttgactttgatgtgctgcctgcatttaat
gccctaggtgaactgaagtctgtctctacacccagccccaggatctatgctgacctcatc
tatttgcctaaatcctcagacgccctggggggagaattttctacctgtttcacggagcta
cagcgcaatttcgtttgctcccggcccaccaaactgaaggatttgattcgcctgactggt
acaaatgggacggtacatacagccaaagcacaacaaagaagcctgcgtgggctgccttta
agctgcaaattgacccttcccagaccagtcccagcgctgcgtctcgagacctgggtgccc
tactccggccccagcagtccttcacgtgcaccctctaaggctcttgctacgctcatttcg
ccttcctgctttagccagtatcgtctgatgttcccactcttccctcagtgtggaagcaaa
ctgaagcaaaaggggcctctgccccccaaatatgccttggagctgcttaccatctacgcc
tgggagcaggggagcggggcgcaggattttgacacggctgaaggtttccggacggtcctg
gagttgatcacaaacgagcagcatctctgtgtcttgtggatggtcaactacaactttgat
gatgagattgtgaggagcttcctcctgacccagatccagagaaccgggtgccccaaacct
cagccccctccatttcttaacctgattccctccaacgctattttggtgacctga

DBGET integrated database retrieval system