KEGG   Delphinapterus leucas (beluga whale): 111162704
Entry
111162704         CDS       T05885                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162704 (OSM)
   04151 PI3K-Akt signaling pathway
    111162704 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162704 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111162704 (OSM)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111162704 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 111162704
NCBI-ProteinID: XP_022406512
UniProt: A0A2Y9LHD9
LinkDB
Position
Unknown
AA seq 246 aa
MRAQCMWRTPLSVILGLLFLSMTATSKCLGKYHELLLQLRRQADLMQDTSTLLDPYIRIQ
GLDTPGLKEHCRECPGAFPSEDALRGLSRQGFLQTLNATLGLVLHRLTALYQDLPEAPQL
VGLNVRGFRSNIHCMSQLLRSSSEAETPEPTQPGPGPTPPPTPPSDAFQHKLKSCRFLHG
YHRFMHSVGQVLQEWGESLSRSRSRRHSPCRAPGDTALARPCRGGARRTGPFRRDRRLMP
RGQLPR
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcgggcacagtgtatgtggaggacaccgctcagtgtgatcctcggactcctgttcctg
agcatgacggccacaagcaagtgcttgggcaagtaccatgaactcctcctgcagctccgg
cgtcaggcggaccttatgcaggacaccagcacgctcctggacccctatatccgcatccaa
ggcctggacacgccaggactgaaggagcactgcagggagtgccctggggctttccccagc
gaggacgccctgcgggggctcagcagacagggcttcctgcagaccctcaatgccacgctg
ggcctcgtcctgcacagactgactgctttgtatcaggacctccctgaagccccgcagttg
gtgggactgaacgtccgcgggttcaggagtaacatccattgcatgtcccagctgctgcgc
agctcctcagaggcagagacacctgagcccactcagccaggccccgggcccacgccaccg
cccacaccgccctcagacgccttccagcacaagttgaagagctgcaggttcctgcacggc
taccaccgcttcatgcactctgtggggcaggtcctccaggagtggggggagagcctgagc
cggagcaggagccggagacacagcccctgccgggcccctggagacacagccctcgccagg
ccctgcagagggggggcccgcaggacggggcccttccggagggacaggagactcatgccg
aggggacagcttccccggtag

KEGG   Delphinapterus leucas (beluga whale): 111162806
Entry
111162806         CDS       T05885                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162806 (LIF)
   04668 TNF signaling pathway
    111162806 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162806 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111162806 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111162806 (LIF)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111162806 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 111162806
NCBI-ProteinID: XP_022406701
UniProt: A0A2Y9LD78
LinkDB
Position
Unknown
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCATRHPCHSNLMNQIKNQLAQLNSSAK
ALFILYYTAQGEPFPNNLDKLCSPNVTDFPPFHANGTERARLVELYRIIAYLGASLGNIT
RDQKVLNPSAHSLHSKLNATADVMRGLLSNVLCRLCSKYHVAHVDVAYGPDTSGKDVFQK
KKLGCQLLGKYKQVIAVVAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctggttctgcactggaaacacgga
gcggggagcccccttcccatcacccctgtcaacgccacctgtgccacacgccacccatgt
cacagcaacctcatgaaccagatcaagaaccagctggcgcagctcaacagcagtgccaaa
gccctctttattctctactacacggcccagggggagccattccccaacaacctggacaag
ctgtgcagccccaatgtgaccgacttcccgcccttccacgccaatggcacggagagggcc
cggctggtggagctgtaccgcatcatcgcgtacctgggcgcctccctgggcaacatcacg
cgggaccagaaggtcctcaatcccagcgcccacagcctgcacagcaagctgaacgccacg
gcggatgtcatgcggggcctcctcagcaacgtgctctgccgcctgtgcagcaagtaccac
gtggcccacgtggacgtggcctacggcccagacacctcaggcaaggacgtcttccagaag
aaaaagctcggctgtcagctcctggggaagtataagcaggtcatcgctgtggtggcccag
gccttctag

KEGG   Delphinapterus leucas (beluga whale): 111163101
Entry
111163101         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163101
   04151 PI3K-Akt signaling pathway
    111163101
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163101
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163101
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163101
   04621 NOD-like receptor signaling pathway
    111163101
   04622 RIG-I-like receptor signaling pathway
    111163101
   04623 Cytosolic DNA-sensing pathway
    111163101
   04650 Natural killer cell mediated cytotoxicity
    111163101
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163101
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111163101
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111163101
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111163101
   05161 Hepatitis B
    111163101
   05160 Hepatitis C
    111163101
   05171 Coronavirus disease - COVID-19
    111163101
   05164 Influenza A
    111163101
   05162 Measles
    111163101
   05168 Herpes simplex virus 1 infection
    111163101
   05163 Human cytomegalovirus infection
    111163101
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163101
   05169 Epstein-Barr virus infection
    111163101
   05165 Human papillomavirus infection
    111163101
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163101
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163101
SSDB
Motif
Pfam: Interferon LMF1
Other DBs
NCBI-GeneID: 111163101
NCBI-ProteinID: XP_030619671
LinkDB
Position
Unknown
AA seq 171 aa
MAQIYLLVAGVILCSIPARPLGWNLPWIHSLQNRELFILLRQMKKIPFQSCLEDRTDFKF
PWKTGNITEILTTQGTGYHHLTLQQMXNFFSKEESQAAWNNTLLHKLLSSLDHTLELLHE
QVENDNLDCPYLGIVVPKYFQRIHLYLKEKEYXPCAWEVIRGEIKVFLSLM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagatctatttgctagtggcaggagtgatactctgctccatccctgctcgccct
cttggctggaatttgccttggatccatagcctacagaacagggaactcttcatacttctg
agacagatgaagaagatcccgtttcagtcatgcctagaggacagaaccgacttcaaattt
ccttggaaaacagggaatatcacagaaatcctgacgactcaaggcaccggctaccaccat
ctgacgctccagcagatgngtaacttcttcagcaaggaggaaagccaagctgcttggaac
aacaccctactccataaactactctctagccttgatcacaccttggaactactgcatgag
caagtggaaaatgacaatctggactgtccatatttgggaattgttgtccctaaatatttc
caaagaatccatctctatctgaaggaaaaggaatacnacccctgtgcctgggaggttatc
agaggagaaattaaagtgttcctttctctcatgtaa

KEGG   Delphinapterus leucas (beluga whale): 111163105
Entry
111163105         CDS       T05885                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04622  RIG-I-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163105 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163105 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111163105 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163105 (IFNE)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163105 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111163105
NCBI-ProteinID: XP_022407268
UniProt: A0A2Y9LPQ4
LinkDB
Position
Unknown
AA seq 193 aa
MINKPFFEIVLVLLASSSVCSRELKLVLFQQKRVNRESLKLLNKLQTSSIQQCLPHRKNF
LLPQKSMNPHQYQKGQALAILHEMLQQIFNLFRAIISLNGWEGSHMEKLLIELHQQLKYL
EGLMRRQAEQKRDTLGSENLRLQVKIYFQRIRDYLENQDYSTCAWTIVQVEINRCLFFVF
RLTGKLSKQGMET
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattaacaagcctttctttgaaattgtgctggtgctgttggcttcttcctctgtctgc
tcccgagagctgaaactggttcttttccaacaaaagagagtgaacagagagagtttaaaa
ctcttgaataaattgcagacctcttcaattcagcagtgtctaccacacaggaaaaacttc
ctgcttccccagaagtctatgaatcctcaccagtaccagaaaggacaagcactggccatt
cttcatgagatgcttcagcagatcttcaacctcttcagggcaattatttctctgaatggt
tgggagggaagccacatggagaagctcctcattgaacttcatcaacagctgaaataccta
gaagggctcatgagacggcaagcagagcagaaaagagacaccttgggcagtgagaacctt
agattacaggttaaaatatatttccaaaggatacgtgattacctggaaaaccaggactat
agcacctgtgcctggaccattgtccaagtagaaatcaaccgatgtctgttctttgtgttc
cgactcacaggaaagctgagcaaacaaggaatggaaacttga

KEGG   Delphinapterus leucas (beluga whale): 111163127
Entry
111163127         CDS       T05885                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04622  RIG-I-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163127 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163127 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111163127 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163127 (IFNK)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163127 (IFNK)
SSDB
Motif
Pfam: Interferon CENP-B_dimeris
Other DBs
NCBI-GeneID: 111163127
NCBI-ProteinID: XP_030619676
LinkDB
Position
Unknown
AA seq 207 aa
MSAEPDVIRKCMWPVCLMGLFVTSVLSLDCNLLNVHLRRVTWQNLSLLRRMSKSFPIECL
RESKAFELPQEILSHTQPLTRDIKEAFYEMSRQAFHIFIQDTFKSTWEEKHLRQVQIGLD
QQLQYLEQCLEEEEENEDMREVAEDERTQSGTPVPQLSNLELRRYFNRIDRFLKDKKYSH
CAWEIVRVEIRRCFYFFHKFTALLRRK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagcgccgagcctgatgtgattagaaagtgtatgtggccggtgtgcctcatgggtctg
tttgtcaccagcgtcctctctctggactgtaacttgctgaatgttcacctgaggagagtc
acctggcaaaatctgagccttctgagaaggatgagcaagtcatttcctatagagtgtcta
agagaaagcaaagcttttgagttgccccaagagatcctctcacacacccagcctctgacg
agggacatcaaggaagccttctatgaaatgtccagacaggccttccacatcttcattcaa
gacaccttcaaatccacttgggaagagaaacacctgagacaagtccaaatcggactcgat
caacagctgcaatacctggaacaatgcttggaagaagaggaggaaaacgaagacatgaga
gaggtggcagaggatgagcggacacagtcaggaactccagtcccccagctgagcaaccta
gagctcaggaggtatttcaacaggatagacaggttcctcaaagataagaaatacagtcac
tgcgcctgggagatcgtccgagtggaaatcagaagatgcttctacttctttcataaattc
acagcactactcaggaggaaataa

KEGG   Delphinapterus leucas (beluga whale): 111163129
Entry
111163129         CDS       T05885                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04622  RIG-I-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163129
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163129
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111163129
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163129
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163129
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111163129
NCBI-ProteinID: XP_022407317
UniProt: A0A2Y9LJS7
LinkDB
Position
Unknown
AA seq 195 aa
MAFVLPLLTALVVFSYGPGGSLGCDLSQNHVRISKKNFMLLGQMRRISPRFCLKDRKDFG
FPQDMVDGSQLPKAQATSVLHEMLQQTFRLFHTERSSAAWDTSLLDKLCTGLHQQLEDLD
ACLVQAMGDEETALGVTGPTLAMKRYFQGIHLYLKEKKYSDCAWEIVRVEIMRSLSSSTN
LQERLRIMNADLGSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctccctctactgaccgccctggtggtgttcagctatggccctggtgga
tctctgggctgcgacctgtctcagaaccacgtgcggattagcaagaagaacttcatgctt
ctgggccagatgcggagaatctcccctcgcttctgtctgaaggacagaaaagacttcggt
ttcccccaggacatggtggatggcagccagctcccgaaggcccaggccacctctgtcctc
cacgagatgctccagcagaccttccgcctcttccacacagagcgctcctctgccgcctgg
gacacctccctcctggacaaactctgcactggactccatcagcagctggaggacctggac
gcctgcttggtgcaggcgatgggagatgaagaaactgccctgggagtgacgggccctaca
ctggccatgaagaggtacttccagggaatccacctctacctgaaagagaagaaatacagt
gactgtgcctgggaaattgtcagagtggaaatcatgagatcgctgtcttcatcaaccaac
ttgcaagaaaggttaagaattatgaatgcagacctgggatcaccttga

KEGG   Delphinapterus leucas (beluga whale): 111163130
Entry
111163130         CDS       T05885                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163130
   04151 PI3K-Akt signaling pathway
    111163130
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163130
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163130
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163130
   04621 NOD-like receptor signaling pathway
    111163130
   04622 RIG-I-like receptor signaling pathway
    111163130
   04623 Cytosolic DNA-sensing pathway
    111163130
   04650 Natural killer cell mediated cytotoxicity
    111163130
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163130
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111163130
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111163130
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111163130
   05161 Hepatitis B
    111163130
   05160 Hepatitis C
    111163130
   05171 Coronavirus disease - COVID-19
    111163130
   05164 Influenza A
    111163130
   05162 Measles
    111163130
   05168 Herpes simplex virus 1 infection
    111163130
   05163 Human cytomegalovirus infection
    111163130
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163130
   05169 Epstein-Barr virus infection
    111163130
   05165 Human papillomavirus infection
    111163130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163130
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163130
SSDB
Motif
Pfam: Interferon CBF CoV_NSP2_N
Other DBs
NCBI-GeneID: 111163130
NCBI-ProteinID: XP_022407318
UniProt: A0A2Y9LPV7
LinkDB
Position
Unknown
AA seq 226 aa
MGSHLRPRPEGRSSENLESRVHRVPTSARPAASAGSPMAPTLSLLLALVLLSCNSNCSLG
CDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFGFPLEAFGGNQFQKAQAIAVVHEM
IQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQACLMQEAGLEGTPLLKEDSILAV
RKYFHRVTVYLQEKKYSPCAWETVRAEVMRSFSSSTNLQERLRRKE
NT seq 681 nt   +upstreamnt  +downstreamnt
atgggttcccatttaagacccaggcctgaaggaaggtcttcagagaacctagagagcagg
gttcacagagtccccacctctgccaggccggcagcatctgcagggtccccgatggcccca
accttgtctttactcctggccctggtgctgctcagctgcaactccaactgctctctgggc
tgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctcctgcaacaa
atgaggagaatctcccccttctcctgcctgaaggacagaaatgactttggattccccctg
gaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtccatgagatg
atccagcagaccttccagctcttcagcacagagggctcggctgccgcttgggatgagacc
ctcctggacaagttctgcactgcactttatcagcagctcactgacctgcaagcctgtctg
atgcaggaggcggggctggaagggactcccctgctgaaggaggactccatcctggctgtg
aggaaatacttccacagagtcactgtctatctgcaagagaagaaatacagcccttgtgcc
tgggagactgtcagagcagaagtcatgagatccttctcttcatcaacaaacttgcaagaa
agactcagaaggaaggaatga

KEGG   Delphinapterus leucas (beluga whale): 111164935
Entry
111164935         CDS       T05885                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7 isoform X1
  KO
K05431  interleukin 7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111164935 (IL7)
   04151 PI3K-Akt signaling pathway
    111164935 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111164935 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111164935 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164935 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111164935 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111164935 (IL7)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111164935 (IL7)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111164935 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 111164935
NCBI-ProteinID: XP_022410708
UniProt: A0A2Y9LZY7
LinkDB
Position
Unknown
AA seq 226 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDIEGKDGGAYQNVLMVNINDLHTFTNIRSDVQV
SKDAASALYIKWHKKMGLCFLVFVPLSSLAEDFAHWPVDSMIDFDSNCLNNEPNFFKKHS
CDDNKEASFLYRAARKLKQFLKMNISDDFNLHLSTVSQGTLTLLNCTNKGKGRKSTSLGE
AQPTKNLEENKSLKEQKKQNDLCFLKILLQKIKTCWNRILRGAKEH
NT seq 681 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagacggcggagcctatcagaatgtt
ctaatggtcaacatcaatgatttgcatacttttacaaatataagaagtgatgtacaagtg
tccaaggatgcagcatctgccctttacatcaaatggcataagaaaatgggactgtgtttt
cttgtctttgttcccctatcaagcttggcagaggactttgcccattggcctgtagacagc
atgatagactttgatagcaattgcctgaataacgaacctaacttttttaaaaaacattca
tgtgatgataataaggaagcttcgtttttatatcgtgctgctcgaaagttgaagcaattc
cttaaaatgaatatcagtgacgatttcaatcttcacctatcaacagtttcacagggcaca
ttaacactgttgaactgcaccaacaagggtaaaggaagaaaatcaacttccctgggtgaa
gcccaacccactaagaatttggaagagaataagtctttaaaggaacagaaaaaacagaat
gacctgtgtttcctaaagatactactacaaaagataaaaacttgttggaatagaattttg
aggggcgctaaagaacattga

KEGG   Delphinapterus leucas (beluga whale): 111170635
Entry
111170635         CDS       T05885                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04620  Toll-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04940  Type I diabetes mellitus
dle05133  Pertussis
dle05134  Legionellosis
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05162  Measles
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111170635 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111170635 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111170635 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    111170635 (IL12B)
   04625 C-type lectin receptor signaling pathway
    111170635 (IL12B)
   04658 Th1 and Th2 cell differentiation
    111170635 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170635 (IL12B)
   05205 Proteoglycans in cancer
    111170635 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111170635 (IL12B)
   05330 Allograft rejection
    111170635 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111170635 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    111170635 (IL12B)
   05134 Legionellosis
    111170635 (IL12B)
   05152 Tuberculosis
    111170635 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111170635 (IL12B)
   05164 Influenza A
    111170635 (IL12B)
   05162 Measles
    111170635 (IL12B)
   05168 Herpes simplex virus 1 infection
    111170635 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111170635 (IL12B)
   05145 Toxoplasmosis
    111170635 (IL12B)
   05140 Leishmaniasis
    111170635 (IL12B)
   05142 Chagas disease
    111170635 (IL12B)
   05143 African trypanosomiasis
    111170635 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111170635 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111170635 (IL12B)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111170635 (IL12B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111170635 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 Ig_2 Ig_4 fn3 I-set
Other DBs
NCBI-GeneID: 111170635
NCBI-ProteinID: XP_022421769
UniProt: A0A2Y9MHX2
LinkDB
Position
Unknown
AA seq 329 aa
MYPQQLVVSWFSLVLLASPIMAIWELEKNVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TSDQSDEVLGSGKTLTIQIKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKSFIKCEAKNYSGHFTCWWLTAISTVLKFSVQSSTGSSDPRGVTCGAATLSAERV
RVDHREYKKYTVGCQEGSACPAAEESLPIEVVVEAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPLKNSRYVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKRERKDKLFTDKTSAKVT
CHKDANVRVQAQDRYYSSYWSEWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtaccctcagcagttggttgtctcctggttttccctggttttgctggcatctcccatc
atggctatatgggaactggagaaaaatgtttatgttgtagaattggattggtatcctgac
gcccctggagaaatggtggttctcacctgcgatacccctgaagaagatggcatcacctgg
acctcagaccagagcgatgaggtcttgggttctggcaaaaccttgaccatccaaatcaaa
gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggttctgagccattcg
ctcctgctgcttcacaaaaaggaagacggaatctggtccactgatatcttaaaggaccag
aaagagcccaaaaataagagctttataaaatgtgaggcaaagaattattccggacatttc
acctgctggtggctgacagcaatcagtactgttttgaaattcagtgtccaaagcagcaca
ggctcctctgacccccgaggggtgacgtgtggagcagcgacgctctcagcagagagggtc
agagtggaccacagggagtataagaagtacacagtggggtgtcaggagggcagcgcctgc
ccagccgccgaggagagcctgcccattgaggtcgtggtggaagctgttcataagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcagctgaagccattaaagaattcccggtatgtggaggtcagctgggagtaccct
gacacctggagcaccccacattcctacttctccctgacattttgtgttcaggtccagggc
aagaacaagagagaaaggaaagataaactcttcacggacaaaacctcagccaaggtcacg
tgccacaaagatgccaacgtccgcgtgcaagcccaggaccgctactacagctcatactgg
agcgaatgggcatctgtgtcctgcagttag

KEGG   Delphinapterus leucas (beluga whale): 111171093
Entry
111171093         CDS       T05885                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04622  RIG-I-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111171093
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111171093
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111171093
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111171093
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111171093
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111171093
NCBI-ProteinID: XP_030619670
LinkDB
Position
Unknown
AA seq 227 aa
MALLRKNVIREPTPKAPPDARLSQASSSLICPMAFVLSLLTALVMFSYGPGGSLGCDLSQ
NHVWVSKKNFMLLGQMRRISPRFCLKDRKDFGFPQDMVDDSHLPKAQATSVLHEMLQQTF
RLFHTERSPAAWDTSLLDKLRTELHQQLEDLDGCLVQAMRDEETALGVTGPTLAVKRYFQ
GIHLYLKEKKYSDCAWEIVRVEIMRSLSSSTNLQERIRTMDGDLGSP
NT seq 684 nt   +upstreamnt  +downstreamnt
atggccttgcttagaaagaatgtcatcagagaacctacccccaaggctcccccagacgcc
cgtctcagccaggccagcagcagcctcatttgccccatggccttcgtgctctctctactg
accgccctggtgatgttcagctacggccctggtggatctctgggttgcgacctgtctcag
aaccacgtgtgggtcagcaagaagaacttcatgcttctgggccagatgcggagaatctcc
cctcgcttctgtctgaaggacagaaaagacttcggtttcccccaggacatggtggatgac
agccacctcccgaaggcccaggccacctctgtcctccacgagatgctccagcagaccttc
cgcctcttccacacagagcgctcccctgctgcctgggacacctccctcctggacaaactc
cgcactgaactccatcagcagctggaggacctggacggctgcttggtgcaggcgatgcga
gatgaagaaactgccctgggagtgacaggccctacactggccgtgaagaggtacttccag
ggaatccatctctacctgaaggagaagaaatacagtgactgtgcctgggaaattgtcaga
gtggaaatcatgagatccctgtcttcatcaaccaacttgcaagaaaggataagaactatg
gatggagacctggggtcaccttga

KEGG   Delphinapterus leucas (beluga whale): 111171121
Entry
111171121         CDS       T05885                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111171121
   04151 PI3K-Akt signaling pathway
    111171121
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111171121
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111171121
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111171121
   04621 NOD-like receptor signaling pathway
    111171121
   04622 RIG-I-like receptor signaling pathway
    111171121
   04623 Cytosolic DNA-sensing pathway
    111171121
   04650 Natural killer cell mediated cytotoxicity
    111171121
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171121
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111171121
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111171121
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111171121
   05161 Hepatitis B
    111171121
   05160 Hepatitis C
    111171121
   05171 Coronavirus disease - COVID-19
    111171121
   05164 Influenza A
    111171121
   05162 Measles
    111171121
   05168 Herpes simplex virus 1 infection
    111171121
   05163 Human cytomegalovirus infection
    111171121
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171121
   05169 Epstein-Barr virus infection
    111171121
   05165 Human papillomavirus infection
    111171121
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111171121
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111171121
SSDB
Motif
Pfam: Interferon CBF CoV_NSP2_N
Other DBs
NCBI-GeneID: 111171121
NCBI-ProteinID: XP_022422467
UniProt: A0A2Y9MTZ8
LinkDB
Position
Unknown
AA seq 133 aa
MTLDSPQEAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQL
TELQACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQENKYSPCAWETVRAEVMRSFS
SSTNLQERLRRKE
NT seq 402 nt   +upstreamnt  +downstreamnt
atgactttggattccccccaggaggcgtttggaggcaaccagttccagaaggctcaagcc
atcgctgtcgtccatgagatgatccagcagaccttccagctcttcagcacagagggctcg
gctgccgcttgggatgagaccctcctggacaagttctgcactgcactttatcagcagctc
actgaactgcaagcctgtctgatgcaggaggcggggctggaagggactcccctgctgaag
gaggactccatcctggctgtgaggaaatacttccacagaatcactgtctatctgcaagag
aacaaatacagcccttgtgcctgggagactgtcagagcagaagtcatgagatccttctct
tcatcaacaaacttgcaagaaagactcaggaggaaggaatga

KEGG   Delphinapterus leucas (beluga whale): 111171122
Entry
111171122         CDS       T05885                                 

Definition
(RefSeq) interferon alpha-1-like isoform X1
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111171122
   04151 PI3K-Akt signaling pathway
    111171122
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111171122
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111171122
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111171122
   04621 NOD-like receptor signaling pathway
    111171122
   04622 RIG-I-like receptor signaling pathway
    111171122
   04623 Cytosolic DNA-sensing pathway
    111171122
   04650 Natural killer cell mediated cytotoxicity
    111171122
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171122
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111171122
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111171122
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111171122
   05161 Hepatitis B
    111171122
   05160 Hepatitis C
    111171122
   05171 Coronavirus disease - COVID-19
    111171122
   05164 Influenza A
    111171122
   05162 Measles
    111171122
   05168 Herpes simplex virus 1 infection
    111171122
   05163 Human cytomegalovirus infection
    111171122
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171122
   05169 Epstein-Barr virus infection
    111171122
   05165 Human papillomavirus infection
    111171122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111171122
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111171122
SSDB
Motif
Pfam: Interferon CBF CoV_NSP2_N
Other DBs
NCBI-GeneID: 111171122
NCBI-ProteinID: XP_022422468
UniProt: A0A2Y9MZC7
LinkDB
Position
Unknown
AA seq 195 aa
MGPTLSLLLALVLLSCNSNCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG
FPPGGVWRQPAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQ
QLTDLQACLMQEAGLEGTPLLKEDSILAVRKYFHRVTVYLQEKKYSPCAWETVRAEVMRS
FSSSTNLQERLRRKE
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggcccaaccttgtctttactcctggccctggtgctgctcagctgcaactccaactgc
tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc
ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga
ttccccccaggaggcgtttggaggcaaccagcgtttggtggcaaccagttccagaaggct
caagccatcgctgtcgtccatgagatgatccagcagaccttccagctcttcagcacagag
ggctcggctgccgcttgggatgagaccctcctggacaagttctgcactgcactttatcag
cagctcactgacctgcaagcctgtctgatgcaggaggcggggctggaagggactcccctg
ctgaaggaggactccatcctggctgtgaggaaatacttccacagagtcactgtctatctg
caagagaagaaatacagcccttgtgcctgggagactgtcagagcagaagtcatgagatcc
ttctcttcatcaacaaacttgcaagaaagactcagaaggaaggaatga

KEGG   Delphinapterus leucas (beluga whale): 111173651
Entry
111173651         CDS       T05885                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111173651 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111173651 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111173651 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    111173651 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111173651 (IL22)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111173651 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A Cobalamin_bind
Other DBs
NCBI-GeneID: 111173651
NCBI-ProteinID: XP_022427151
UniProt: A0A2Y9N1X5
LinkDB
Position
Unknown
AA seq 189 aa
MAARQKSMSSSLMGTLVASCLLLMALWVQGGAAVPIVSQCRLDRANFQQPYITNRTFALA
HEASLADNNTDVRLIGTKLFQGVKMMERCCMLKQVLNFTLEEVLLPQSNRFKPYMQEVVP
FLARLNKKLGQCHMECDNQNIQRNVQNLKDTVKKLGESGEIKVIGELNLLFMALKNECTR
PGQSSEMDN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctgcccggcagaaatctatgagctcttcccttatggggaccctggtggccagctgc
ctcctcctcatggccctgtgggtgcagggaggagcggctgtgcccattgtgtcgcagtgc
aggctcgacagggccaacttccagcagccttacatcaccaaccgcaccttcgcgttggct
catgaggctagtttggcagataacaacacagatgttcgtctcattgggaccaaactgttc
cagggagtcaagatgatggagcgctgctgtatgctgaagcaggtgctgaactttaccctt
gaagaggtgctgctcccccaatccaatagattcaagccctacatgcaggaggtggtgccc
ttcctggccaggctcaacaaaaagctaggccaatgccatatggagtgtgacaaccagaat
atccagagaaatgtacagaatctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagtaattggagaactgaatttgctgtttatggccctgaaaaatgaatgcactcgt
ccagggcaaagctcggaaatggataactaa

KEGG   Delphinapterus leucas (beluga whale): 111173709
Entry
111173709         CDS       T05885                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05133  Pertussis
dle05152  Tuberculosis
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111173709 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111173709 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111173709 (IL23A)
   04659 Th17 cell differentiation
    111173709 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173709 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111173709 (IL23A)
   05321 Inflammatory bowel disease
    111173709 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    111173709 (IL23A)
   05152 Tuberculosis
    111173709 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111173709 (IL23A)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111173709 (IL23A)
SSDB
Motif
Pfam: IL23
Other DBs
NCBI-GeneID: 111173709
NCBI-ProteinID: XP_030618914
LinkDB
Position
Unknown
AA seq 107 aa
FFSPQSCLQRIHQGLVFYEKLLGSDIFTGEPSLVLDGPVGQLHASLLGLRELLQPEGHHW
EIEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSP
NT seq 324 nt   +upstreamnt  +downstreamnt
ttcttttctccccagtcctgcttgcaaaggatccaccaaggcttggttttttacgagaag
ctgctgggctcagatattttcacaggggagccttctctagtcctcgatggccctgtgggc
cagcttcatgcctccctactgggcctcagggaactcttgcagcccgagggtcaccactgg
gagattgagcagactccaagtcccagtcccagccagccgtggcagcgcctccttctccgc
ctcaagatccttcgcagcctccaggcctttgtggctgtagctgccagggtctttgcccat
ggagcagcaactctgagcccctaa

KEGG   Delphinapterus leucas (beluga whale): 111173770
Entry
111173770         CDS       T05885                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03050  Proteasome
dle04060  Cytokine-cytokine receptor interaction
dle04066  HIF-1 signaling pathway
dle04217  Necroptosis
dle04350  TGF-beta signaling pathway
dle04380  Osteoclast differentiation
dle04612  Antigen processing and presentation
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04940  Type I diabetes mellitus
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
dle05322  Systemic lupus erythematosus
dle05323  Rheumatoid arthritis
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    111173770 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111173770 (IFNG)
   04630 JAK-STAT signaling pathway
    111173770 (IFNG)
   04066 HIF-1 signaling pathway
    111173770 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111173770 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111173770 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111173770 (IFNG)
   04612 Antigen processing and presentation
    111173770 (IFNG)
   04660 T cell receptor signaling pathway
    111173770 (IFNG)
   04658 Th1 and Th2 cell differentiation
    111173770 (IFNG)
   04659 Th17 cell differentiation
    111173770 (IFNG)
   04657 IL-17 signaling pathway
    111173770 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111173770 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111173770 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111173770 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    111173770 (IFNG)
   05323 Rheumatoid arthritis
    111173770 (IFNG)
   05321 Inflammatory bowel disease
    111173770 (IFNG)
   05330 Allograft rejection
    111173770 (IFNG)
   05332 Graft-versus-host disease
    111173770 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111173770 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111173770 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111173770 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111173770 (IFNG)
   05164 Influenza A
    111173770 (IFNG)
   05168 Herpes simplex virus 1 infection
    111173770 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111173770 (IFNG)
   05144 Malaria
    111173770 (IFNG)
   05145 Toxoplasmosis
    111173770 (IFNG)
   05140 Leishmaniasis
    111173770 (IFNG)
   05142 Chagas disease
    111173770 (IFNG)
   05143 African trypanosomiasis
    111173770 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dle03051]
    111173770 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111173770 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111173770 (IFNG)
Proteasome [BR:dle03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111173770 (IFNG)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111173770 (IFNG)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111173770 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5
Other DBs
NCBI-GeneID: 111173770
NCBI-ProteinID: XP_022427303
UniProt: A0A2Y9NDI2
LinkDB
Position
Unknown
AA seq 166 aa
MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWK
DESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQ
IPVDDLQIQRKAISELIKVMKDLSPRSNLRKRRRSQNLFRGQRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatataccagttatttcttagcttttcagctatgcgtgattttgggttcttctggc
tcttactgccaggccccattttttaaagaaatacagaacctaaaggaatattttaatgca
agtaacccagatgtagctggtggtgggcctcttttcttagaaattttggagaattggaaa
gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt
gaaaacttaaaaggtaaccagatcattcaaaggagcatggatatcatcaagcaggacatg
tttcagaagttcttaaatggcagctctgagaaactggatgacttcaaaaagctgattcaa
attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg
aaggacctgtcgccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga
ggccagagagcgtcgaaataa

KEGG   Delphinapterus leucas (beluga whale): 111174517
Entry
111174517         CDS       T05885                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04620  Toll-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04940  Type I diabetes mellitus
dle05133  Pertussis
dle05134  Legionellosis
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05162  Measles
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111174517 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111174517 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111174517 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    111174517 (IL12A)
   04625 C-type lectin receptor signaling pathway
    111174517 (IL12A)
   04658 Th1 and Th2 cell differentiation
    111174517 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174517 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111174517 (IL12A)
   05330 Allograft rejection
    111174517 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111174517 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    111174517 (IL12A)
   05134 Legionellosis
    111174517 (IL12A)
   05152 Tuberculosis
    111174517 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111174517 (IL12A)
   05164 Influenza A
    111174517 (IL12A)
   05162 Measles
    111174517 (IL12A)
   05168 Herpes simplex virus 1 infection
    111174517 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111174517 (IL12A)
   05144 Malaria
    111174517 (IL12A)
   05145 Toxoplasmosis
    111174517 (IL12A)
   05140 Leishmaniasis
    111174517 (IL12A)
   05142 Chagas disease
    111174517 (IL12A)
   05143 African trypanosomiasis
    111174517 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111174517 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111174517 (IL12A)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111174517 (IL12A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111174517 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 111174517
NCBI-ProteinID: XP_022429128
UniProt: A0A2Y9NIK9
LinkDB
Position
Unknown
AA seq 222 aa
MCPPRTLLLVATLVLLHHLNHFSLARSLPATTAGPGMFQCLNHSQNLLRAVSNTLEKARQ
TLEFYSCTSEEIDHEDITKDRTSTVEACLPLELATNESCLASRETSLITNGSCLASRRSS
FMTTLCLSSIYEDLRMYHMEFQAMNAKLLMDPKRQIFVDQNMLAAVAELMQALNSHSKIV
SQKPSLGELDFYKTKVKLCILLHAFRIRVVTIDRMMSYLSSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgcccgcctcgcaccctcctccttgtggccaccctggtcctcctccaccacctgaac
cactttagtttggccaggagcctccccgccaccacagcgggccccggaatgttccagtgc
ctcaaccactcccaaaacctgctgagagccgtcagcaacacccttgagaaggccagacaa
accctagaattttactcctgcacttctgaagagattgatcacgaagatatcaccaaagat
agaaccagcacagtggaggcctgcttaccactggaattagccacgaatgagagttgcctg
gcttccagagagacctctttaataactaatgggagttgcctggcttccagaaggagctct
tttatgacgaccctgtgccttagcagtatctatgaggacttgaggatgtaccacatggag
ttccaggccatgaacgcaaagctcctgatggatcctaagaggcagatctttgtggatcag
aacatgctggcggctgttgctgagctgatgcaggccctgaattcccacagcaagattgtg
tcacagaaaccctccctgggagaactggatttttataagactaaagtcaagctctgcata
cttcttcatgccttcagaattcgtgtggtgaccatcgacagaatgatgagctatctgagt
tcttcctaa

KEGG   Delphinapterus leucas (beluga whale): 111174560
Entry
111174560         CDS       T05885                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04668  TNF signaling pathway
dle05135  Yersinia infection
dle05142  Chagas disease
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111174560 (IFNB1)
   04668 TNF signaling pathway
    111174560 (IFNB1)
   04151 PI3K-Akt signaling pathway
    111174560 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111174560 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111174560 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111174560 (IFNB1)
   04621 NOD-like receptor signaling pathway
    111174560 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    111174560 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    111174560 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    111174560 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111174560 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111174560 (IFNB1)
   05152 Tuberculosis
    111174560 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111174560 (IFNB1)
   05161 Hepatitis B
    111174560 (IFNB1)
   05160 Hepatitis C
    111174560 (IFNB1)
   05171 Coronavirus disease - COVID-19
    111174560 (IFNB1)
   05164 Influenza A
    111174560 (IFNB1)
   05162 Measles
    111174560 (IFNB1)
   05168 Herpes simplex virus 1 infection
    111174560 (IFNB1)
   05163 Human cytomegalovirus infection
    111174560 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174560 (IFNB1)
   05169 Epstein-Barr virus infection
    111174560 (IFNB1)
   05165 Human papillomavirus infection
    111174560 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111174560 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111174560 (IFNB1)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111174560 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111174560
NCBI-ProteinID: XP_022429154
UniProt: A0A2Y9N397
LinkDB
Position
Unknown
AA seq 185 aa
MTHRCILQIALLLCFSTTALSTSYRLLQFQQRSSNLACQKLLQQLPGMPQHCLEDRMDFK
VPEEIKQPQQFQKEDAVLVIYEMLQQIFGILRRNFSSTGWTKTITENLLVEVYGQMDRLE
NILEEIMEKENFTRGVNILHLKKYYLQIVQYLKSKEYSNCAWTVVRVEILRNFSFLNRLT
DYLHN
NT seq 558 nt   +upstreamnt  +downstreamnt
atgacccacaggtgcatcctccaaatcgctctcctgttgtgcttctccaccacagctctt
tccacgagctacagattgcttcaattccaacaaaggagcagcaatttggcgtgtcagaaa
ctcctgcagcagttacctggaatgcctcaacattgcctcgaggacaggatggacttcaag
gtccctgaggagattaagcaaccacagcagttccagaaggaagacgccgtattggtcatc
tatgagatgctccagcagatctttggtattctcagaagaaatttctctagcaccggctgg
actaagaccatcactgagaacctccttgtggaagtctatgggcagatggatcgtctggag
aatatcctggaggaaataatggagaaggaaaacttcaccaggggagtgaacattcttcac
ctgaagaaatactacttgcagatcgtgcagtacctgaagtccaaggagtacagcaactgt
gcctggacagtagtgcgagtggaaatcctcaggaacttttccttccttaaccgccttaca
gattacctccataattga

KEGG   Delphinapterus leucas (beluga whale): 111175147
Entry
111175147         CDS       T05885                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04657  IL-17 signaling pathway
dle04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111175147 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111175147 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111175147 (IL17D)
   04659 Th17 cell differentiation
    111175147 (IL17D)
   04657 IL-17 signaling pathway
    111175147 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111175147 (IL17D)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111175147 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 111175147
NCBI-ProteinID: XP_022430174
UniProt: A0A2Y9N624
LinkDB
Position
Unknown
AA seq 309 aa
MFGACISEVLVGQIRTASWCLGEGEAPPPPVRNALHLQSLRGSRGEEAASRLRARLSRCL
SRSRGAFVWEALRGGRTRPTSLPAEAPPSAQRRAAPFGTCPRLRDYRSHFGAMLGPPVWA
LVAGVLLALSPGRAEGAPRAGRRPARARGCADRPEELLEQLYGRLAAGVLGAFHHTLQLG
PREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPGRFPRYLPEAYCLCRGCLT
GPRGEEDVRLRSVPVLVPAVVLRRTPACAGGRAVYTEEYVTIPVGCTCVPGPDKDADGAN
SSLDKPARP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgtttggtgcttgtatttcggaggtgctagtggggcagataaggaccgcttcctggtgt
ctgggggaaggagaagcgcccccgccccccgttcggaacgctctccatctccagtccctc
agaggaagtcgtggcgaagaagctgcttccaggctccgcgcgcgcctctccaggtgcctg
tcccgctcccgcggcgccttcgtctgggaggctcttcgcggcggccggacccggccgact
tcccttccagccgaggcgcctccttccgctcagcgccgcgcggctccgttcgggacgtgt
ccgcgcctccgcgactaccggagccacttcggggcgatgctggggccgccggtctgggcg
ctggtggccggcgtcctgctggcgctgtcgccgggccgggcggagggcgccccgagggcg
ggccggcggccggcgcgggcgcggggctgcgcggaccggcccgaggagcttctggagcag
ctgtacgggcgactggcggctggtgtgctcggcgccttccaccacacgctgcagctgggc
ccgcgcgagcaggcgcgcaacgccagctgcccggccgggggcaggcccgccgaccgccgc
ttccggccgcccaccaacctgcgcagcgtgtctccctgggcctacaggatctcctacgac
cccggccgcttccccaggtacctgcccgaggcctattgcctgtgccggggctgcctgacc
gggccgcgcggggaggaggatgtgcggctgcgcagcgtcccggtgctcgtgcccgcggtg
gtcctgcgccggaccccagcctgcgcgggcggccgcgccgtctataccgaggagtacgtc
accatccccgtgggctgcacctgcgtgcccgggccagacaaggatgcagacggtgccaac
tccagcctggacaagccggcccggccctga

KEGG   Delphinapterus leucas (beluga whale): 111180531
Entry
111180531         CDS       T05885                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111180531
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111180531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111180531
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111180531
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 111180531
NCBI-ProteinID: XP_022440621
UniProt: A0A2Y9P5V9
LinkDB
Position
Unknown
AA seq 113 aa
MVALQVWERPVALEAELALTLNVLEASANSSPDHILDQPLHTLHHIHSKLQACVPAWPTA
GPRPRGRLHHWLHRLQEAPKKESQDCLEASVMFNLFRLLTRDLKCVASGDQCV
NT seq 342 nt   +upstreamnt  +downstreamnt
atggttgctctgcaggtgtgggagcgccccgtggccttggaggcggagctggccctgaca
ctgaatgtcctggaggcctcggctaactcatccccggatcacatcctggaccagcccctt
cacacgctgcaccacatccactccaagctccaggcctgcgtcccagcttggcccacagca
ggccccaggccccggggccgcctccaccactggctgcaccggctccaggaggccccgaag
aaggagtcccaggactgcctcgaagcctctgtcatgttcaacctcttccgcctcctcacc
cgggacctgaaatgtgttgccagtggtgaccagtgtgtctga

KEGG   Delphinapterus leucas (beluga whale): 111180533
Entry
111180533         CDS       T05885                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111180533
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111180533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111180533
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111180533
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 111180533
NCBI-ProteinID: XP_022440622
UniProt: A0A2Y9PBE9
LinkDB
Position
Unknown
AA seq 110 aa
PQVWERPVALEAELALTLNVLEATANSSPDHILDQPLHTLHHIHSKLQACVPAWPTAGPR
PRGRLHHWLHRLQEAPKKEPQDCLEASVMFNLFRLLTRDLKCVASGDQCV
NT seq 333 nt   +upstreamnt  +downstreamnt
cctcaggtgtgggagcgccccgtggccttggaggcggagctggccctgacactgaatgtc
ctggaggccacggctaactcatccccggatcacatcctggaccagccccttcacacgctg
caccacatccactccaagctccaggcctgcgtcccagcttggcccacagcaggccccagg
ccccggggccgcctccaccactggctgcaccggctccaggaggccccgaagaaggagccc
caggactgcctcgaagcctctgtcatgttcaacctcttccgcctcctcacccgggacctg
aaatgtgttgccagtggtgaccagtgtgtctga

KEGG   Delphinapterus leucas (beluga whale): 111181029
Entry
111181029         CDS       T05885                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111181029 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111181029 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111181029 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    111181029 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111181029 (IL11)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111181029 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 111181029
NCBI-ProteinID: XP_022441761
UniProt: A0A2Y9P954
LinkDB
Position
Unknown
AA seq 199 aa
MNSVCCLVLVALSLWPGRAAAPGPPPGPPRASPDPRAELDSAVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLFSYLRHVQWLRRAGGPSLR
TLEPDLGALQARLDRLLRRLQLLMSRLALPQAPPDPPAPPLAPPASPWGGVRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaacagtgtttgctgtctggtcctggtcgcgctgagcctgtggccaggtagagctgct
gccccggggccacctcctggccccccacgggcctccccagaccctcgggctgagctggac
agcgccgtcctcctgacccgctctctcctggcggacactcggcagctggccgcacagctg
agagacaaattcccagctgacggagaccacaacctggattccctccccaccttggccatg
agtgcgggggcgctgggagccctgcagctcccgggagtgctgacacggctgcgggcagac
ctgttctcctacctaaggcatgtgcagtggctgcgccgggcaggaggcccttccctgcgg
accctggagcccgatctaggcgccctgcaggcccggttggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccaggcgcccccagacccaccggcacccccc
ctggctcccccggcctcaccctggggaggcgtccgggcggcccatgccatccttgggggg
ctgcacctgacgctcgactgggctgtgcggggcttgctgctgctgaagactcggctgtga

KEGG   Delphinapterus leucas (beluga whale): 111181978
Entry
111181978         CDS       T05885                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01523  Antifolate resistance
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04657  IL-17 signaling pathway
dle04659  Th17 cell differentiation
dle04668  TNF signaling pathway
dle04672  Intestinal immune network for IgA production
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05010  Alzheimer disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
dle05332  Graft-versus-host disease
dle05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111181978 (IL6)
   04668 TNF signaling pathway
    111181978 (IL6)
   04066 HIF-1 signaling pathway
    111181978 (IL6)
   04068 FoxO signaling pathway
    111181978 (IL6)
   04151 PI3K-Akt signaling pathway
    111181978 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111181978 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111181978 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111181978 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111181978 (IL6)
   04620 Toll-like receptor signaling pathway
    111181978 (IL6)
   04621 NOD-like receptor signaling pathway
    111181978 (IL6)
   04623 Cytosolic DNA-sensing pathway
    111181978 (IL6)
   04625 C-type lectin receptor signaling pathway
    111181978 (IL6)
   04659 Th17 cell differentiation
    111181978 (IL6)
   04657 IL-17 signaling pathway
    111181978 (IL6)
   04672 Intestinal immune network for IgA production
    111181978 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181978 (IL6)
   05202 Transcriptional misregulation in cancer
    111181978 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111181978 (IL6)
   05321 Inflammatory bowel disease
    111181978 (IL6)
   05332 Graft-versus-host disease
    111181978 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111181978 (IL6)
   05020 Prion disease
    111181978 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    111181978 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111181978 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111181978 (IL6)
   04931 Insulin resistance
    111181978 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111181978 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111181978 (IL6)
   05135 Yersinia infection
    111181978 (IL6)
   05133 Pertussis
    111181978 (IL6)
   05134 Legionellosis
    111181978 (IL6)
   05152 Tuberculosis
    111181978 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111181978 (IL6)
   05161 Hepatitis B
    111181978 (IL6)
   05171 Coronavirus disease - COVID-19
    111181978 (IL6)
   05164 Influenza A
    111181978 (IL6)
   05162 Measles
    111181978 (IL6)
   05168 Herpes simplex virus 1 infection
    111181978 (IL6)
   05163 Human cytomegalovirus infection
    111181978 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111181978 (IL6)
   05169 Epstein-Barr virus infection
    111181978 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111181978 (IL6)
   05144 Malaria
    111181978 (IL6)
   05142 Chagas disease
    111181978 (IL6)
   05143 African trypanosomiasis
    111181978 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111181978 (IL6)
   01523 Antifolate resistance
    111181978 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111181978 (IL6)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111181978 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23 Mod_r Sec16
Other DBs
NCBI-GeneID: 111181978
NCBI-ProteinID: XP_030615680
LinkDB
Position
Unknown
AA seq 208 aa
MNSLSTIAFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLLLTSPDKTEALIKYILGKIS
AMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLLEYQIY
LDYLQNEYEGDKGSIEAVQISIKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQSQNDD
WMKNTKIILILRSLENFLQFSLRAVRIK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaatcgccttctccctggggctgctcctggtgacggctactgct
ttccctaccccgggacccctgggagaagatttcaaagatgataccacttcagacagacta
ctcctcacctctccagacaaaactgaagctctcattaagtacatcctcggcaaaatctcc
gcaatgagaaaggagatgtgtgagaagtatgacaagtgtgaaaacagcaaggaggcactg
gcagaaaacaatctgaaccttccaaaaatggcagaaaaagacggatgcttccaatctggg
ttcaatcaggagacttgcttgatgagaatcaccaccggtcttctggagtatcagatatac
ctggactacctccagaacgagtatgagggtgataagggaagcatcgaggctgtgcagatt
agcatcaaagcactggcccagatcctgaggcaaaaggtcaagaatccagatgaagtaacc
acccctgacccaactacaaatgccagcctgatgaataacctgcagtcgcagaacgatgac
tggatgaagaacacaaagattatcctcatcctgcgaagccttgagaacttcctgcagttc
agcctgagggctgttcggatcaagtag

KEGG   Delphinapterus leucas (beluga whale): 111182131
Entry
111182131         CDS       T05885                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1 isoform X1
  KO
K05422  cardiotrophin 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182131 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182131 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182131 (CTF1)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111182131 (CTF1)
SSDB
Motif
Pfam: PRF pPIWI_RE_X Nup54
Other DBs
NCBI-GeneID: 111182131
NCBI-ProteinID: XP_022443986
UniProt: A0A2Y9PFB7
LinkDB
Position
Unknown
AA seq 264 aa
MIWGQGTHFRRTTVWQMSGALFSLSWNGTEPAWLKRWRIQSGASGFRKSQPGRSGQEARG
WGALIPPPLFPPEDPQADSSISPLPHLESKIQQTHSLARLLTKYAEQLLQEYVQHQGDPF
GLPGFSPPRLPVADLSAPAPGHAGLPVPERLRLDEAALAALPPLLDVVRRRQAELNPRAL
RLLRRLEDAARQARALGAAVEAVLAALGAETRGPRPEPNAIAAATVTAGVFPAKVLGLRV
CGLYREWVSRTEADLGQLAPGGPA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgatttggggacagggaacacatttcaggagaacaaccgtttggcaaatgtctggtgcc
ctattttccctcagttggaatgggacagaacctgcctggcttaaaaggtggagaattcag
agtggagcttccgggttcaggaagagccagcctggaagaagtggtcaagaagcaaggggt
tggggtgccctcattcctcccccccttttcccaccagaggacccccaggctgactcctca
atctcaccccttccccacttggagtccaagatccaacagacacacagccttgcccgcctc
ctcaccaaatatgctgagcagctgctccaggaatatgtgcagcaccagggagaccccttc
gggctgcctggcttctcgcccccgcggctgccggtggccgatctgagcgccccggccccg
ggccacgcgggcctgccagtgcccgagcgcctgcggctggacgaggcggcgctagccgcg
ctgccaccgctgctggacgtcgtgcgccgccgccaggccgagctgaacccgcgcgcgctg
cgcctgctgcggcgcctggaggacgcggcgcgccaggcgcgggccctgggcgccgccgtg
gaggccgtgctggccgcgctgggcgccgagacccgtgggccccgaccggagcccaacgcc
attgccgcggccactgtcaccgcgggcgtcttcccggccaaggtgctggggctccgcgtg
tgcggcctctaccgcgagtgggtgagccgcaccgaggccgacctaggccagctggcgccc
gggggcccggcctaa

KEGG   Delphinapterus leucas (beluga whale): 111182135
Entry
111182135         CDS       T05885                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182135
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182135
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111182135
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 111182135
NCBI-ProteinID: XP_022443992
UniProt: A0A2Y9PL19
LinkDB
Position
Unknown
AA seq 202 aa
FLLPAALCLLTLLLPPLSLGAPISPAEPISQAYSLALYMQKNTSTLLQTYLQCQGSPFSD
PGFSAPELQLSSLPPAAVSFKTWHALNDRERLSCAQGAFLALTQHLQLVGDDQSDLNPGS
PILLAQLGAATLRAQGLLGNMAAIMTALGLPIPPEEDTLGLVPFGASAFERKCRGYVVTW
EYGHWTDRAVRDLALLKAKYPG
NT seq 609 nt   +upstreamnt  +downstreamnt
tttctcctgccagccgccctctgcctgctgaccctgctgctgccacccctcagtctggga
gcccctatctccccagctgagcccatcagtcaagcctacagcctggcactctacatgcag
aagaatacttcaacactgctgcagacttatctccagtgccaaggcagcccctttagtgat
cctggcttctcagcgccagagctccagctcagcagcctgcctcctgccgccgtctccttc
aagacctggcatgcgctgaatgatagggagcgtctgagctgtgcccagggggccttcctg
gccttgacccagcacctccagctcgtgggggatgaccagagtgacctgaaccctggcagt
cccatccttctggctcagctaggggctgcaacactcagggcccaaggcctgctgggcaac
atggctgccatcatgactgccctgggcctgcctatccccccagaagaggacactctcggg
cttgtccccttcggggcctcggccttcgagaggaaatgtcgaggttatgtagtaacctgg
gaatatggccactggactgaccgagctgtgagggacttggctctgctcaaggccaaatac
cctgggtag

KEGG   Delphinapterus leucas (beluga whale): 111182348
Entry
111182348         CDS       T05885                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04664  Fc epsilon RI signaling pathway
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05221  Acute myeloid leukemia
dle05310  Asthma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182348
   04151 PI3K-Akt signaling pathway
    111182348
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182348
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111182348
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182348
   04664 Fc epsilon RI signaling pathway
    111182348
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182348
   05202 Transcriptional misregulation in cancer
    111182348
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111182348
  09163 Immune disease
   05310 Asthma
    111182348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182348
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182348
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182348
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111182348
SSDB
Motif
Pfam: IL3 Hs1pro-1_C BRICHOS
Other DBs
NCBI-GeneID: 111182348
NCBI-ProteinID: XP_030618570
LinkDB
Position
Unknown
AA seq 149 aa
MRSLPILHRLLFLLALHTPQAQGAPVKTPGTQQCYVLSLIREIINELDKLHVASEDFLNS
NEKRRLMKTSLWRPNLEKFLTFATNSLGEDSKITKNLKEIQPILPTTMTTEEPILIEKDN
LGDFWVKLKEYLSAIRDSLNCKNTQRPNV
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcgcagcctgcccatcctgcatcggctcctgttcctgctcgcactccacacccctcag
gcacaaggggcaccggtcaagacaccaggaacccaacaatgctatgtactcagcctgatc
cgggaaattataaatgagctagacaagctacatgtggcttcagaagacttcttgaactca
aacgaaaagaggaggctgatgaaaacaagcctctggcggccaaacctggaaaaattcctg
acatttgccacaaattcccttggagaggattcgaaaatcacgaaaaatcttaaggaaatc
cagccaatcctgcccacaaccatgaccacggaagagccaatccttattgagaaggataac
ttgggtgatttctgggtgaaactgaaggaatatctgtctgccattagagactctctgaat
tgtaagaacacacagagacctaacgtctga

KEGG   Delphinapterus leucas (beluga whale): 111182406
Entry
111182406         CDS       T05885                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04650  Natural killer cell mediated cytotoxicity
dle04657  IL-17 signaling pathway
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle05146  Amoebiasis
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05171  Coronavirus disease - COVID-19
dle05202  Transcriptional misregulation in cancer
dle05221  Acute myeloid leukemia
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182406 (CSF2)
   04668 TNF signaling pathway
    111182406 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182406 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182406 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    111182406 (CSF2)
   04660 T cell receptor signaling pathway
    111182406 (CSF2)
   04657 IL-17 signaling pathway
    111182406 (CSF2)
   04664 Fc epsilon RI signaling pathway
    111182406 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111182406 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111182406 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111182406 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111182406 (CSF2)
   05171 Coronavirus disease - COVID-19
    111182406 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111182406 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111182406 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111182406 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182406 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182406 (CSF2)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     111182406 (CSF2)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111182406 (CSF2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111182406 (CSF2)
SSDB
Motif
Pfam: GM_CSF DUF1722
Other DBs
NCBI-GeneID: 111182406
NCBI-ProteinID: XP_022444446
UniProt: A0A2Y9PGP5
LinkDB
Position
Unknown
AA seq 144 aa
MWLQNLLLLSTVVCSTSAPTHPPSPATRPWQHVDAIKEALSILNHSKDTAAVMNETTEVI
SEMFDSQEPTCLQTRLELYKQGLRGSLTSLEGPLSMMASHYKQHCPPTQETSCETQIITF
KSFKENLKDFLFTIPFDCWEAVQK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctacttctcctgagcactgtggtctgcagcacctccgcacccacc
cacccacccagccctgccacccggccctggcagcatgtggatgccatcaaggaggccctg
agcattctgaaccacagtaaagacactgctgctgtgatgaatgaaacaacagaagtcatc
tctgaaatgtttgactcccaggagccgacatgcctgcagactcgcctggaactgtacaag
cagggcctgcggggcagcctcactagtctcgagggccccttgagcatgatggccagccac
tacaagcagcactgcccccccactcaggaaacttcttgtgaaacccagattatcaccttt
aaaagtttcaaagagaacctgaaggattttctttttaccatcccctttgactgctgggag
gcagtccagaagtga

KEGG   Delphinapterus leucas (beluga whale): 111182417
Entry
111182417         CDS       T05885                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04672  Intestinal immune network for IgA production
dle05200  Pathways in cancer
dle05310  Asthma
dle05320  Autoimmune thyroid disease
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182417 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182417 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182417 (IL5)
   04660 T cell receptor signaling pathway
    111182417 (IL5)
   04658 Th1 and Th2 cell differentiation
    111182417 (IL5)
   04657 IL-17 signaling pathway
    111182417 (IL5)
   04664 Fc epsilon RI signaling pathway
    111182417 (IL5)
   04672 Intestinal immune network for IgA production
    111182417 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182417 (IL5)
  09163 Immune disease
   05310 Asthma
    111182417 (IL5)
   05320 Autoimmune thyroid disease
    111182417 (IL5)
   05321 Inflammatory bowel disease
    111182417 (IL5)
   05330 Allograft rejection
    111182417 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182417 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182417 (IL5)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182417 (IL5)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111182417 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 111182417
NCBI-ProteinID: XP_022444472
UniProt: A0A2Y9PMF3
LinkDB
Position
Unknown
AA seq 135 aa
MRMLLHLSLLALGAVYICVIAVESPMNRLVAETLTLLSTHQTLLIGDGNLMIPTPEHTNH
ELCIKEVFQGIDTLKNQTAQGDAVEKLFQNLFLIKEYIIDLQRKKCGGERWRVKQFLDYL
QTFLKVINTEWTTES
NT seq 408 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgagtttgctggctcttggagctgtctacatttgtgtcatt
gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat
caaactctgctgataggtgacgggaatttgatgattcctactcccgaacatacaaatcac
gagctatgcattaaagaagtctttcagggaatagacacactgaagaatcaaactgcacaa
ggggatgctgtggaaaaactattccaaaacttgtttttaataaaagaatacataatagac
ctccaaagaaagaagtgtggaggagaaagatggagagtaaaacaattcctagactacctg
caaacttttcttaaggtgataaacaccgagtggacaacggaaagttga

KEGG   Delphinapterus leucas (beluga whale): 111182418
Entry
111182418         CDS       T05885                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04672  Intestinal immune network for IgA production
dle05140  Leishmaniasis
dle05200  Pathways in cancer
dle05310  Asthma
dle05320  Autoimmune thyroid disease
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182418 (IL4)
   04151 PI3K-Akt signaling pathway
    111182418 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182418 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182418 (IL4)
   04660 T cell receptor signaling pathway
    111182418 (IL4)
   04658 Th1 and Th2 cell differentiation
    111182418 (IL4)
   04659 Th17 cell differentiation
    111182418 (IL4)
   04657 IL-17 signaling pathway
    111182418 (IL4)
   04664 Fc epsilon RI signaling pathway
    111182418 (IL4)
   04672 Intestinal immune network for IgA production
    111182418 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182418 (IL4)
  09163 Immune disease
   05310 Asthma
    111182418 (IL4)
   05320 Autoimmune thyroid disease
    111182418 (IL4)
   05321 Inflammatory bowel disease
    111182418 (IL4)
   05330 Allograft rejection
    111182418 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111182418 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182418 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182418 (IL4)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182418 (IL4)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111182418 (IL4)
SSDB
Motif
Pfam: IL4 DUF4798
Other DBs
NCBI-GeneID: 111182418
NCBI-ProteinID: XP_022444473
UniProt: A0A2Y9PNT9
LinkDB
Position
Unknown
AA seq 133 aa
MGLTSQLIPMLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNLCMELPVEDVFATT
KNTTEKETFCRAGTVLRHIYRYHKCFNKPLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE
TLKTIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac
ttcgtccatggacacaagtgcgatattaccttacaagagatcatcaaaacgctgaacatc
ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca
aagaacacaactgagaaggaaactttctgcagggccgggactgtgcttcggcatatctac
agataccacaagtgcttcaacaaacccctgagtggacttcacaggaacctcagcagcatg
gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa
acgctaaagacgattatgaaggagaaatactcaaagtgttga

KEGG   Delphinapterus leucas (beluga whale): 111182419
Entry
111182419         CDS       T05885                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04664  Fc epsilon RI signaling pathway
dle05200  Pathways in cancer
dle05310  Asthma
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182419 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182419 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111182419 (IL13)
   04657 IL-17 signaling pathway
    111182419 (IL13)
   04664 Fc epsilon RI signaling pathway
    111182419 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182419 (IL13)
  09163 Immune disease
   05310 Asthma
    111182419 (IL13)
   05321 Inflammatory bowel disease
    111182419 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182419 (IL13)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182419 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 111182419
NCBI-ProteinID: XP_022444474
UniProt: A0A2Y9PC43
LinkDB
Position
Unknown
AA seq 131 aa
MALWLTVVIALTCFGGLASLGPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSVNLTA
NMYCSALEALINVSNCSAIQRTQRMLNALCLHKPSAAVSSEHIRDTKIEVAHFLKDLLKH
SRIIFHYGKFS
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctggttgactgtggtcattgctctcacctgctttggtggcctcgcctccctg
ggccctgtgcctccctctacagccctcaaggagctcattgaagagctggtcaatatcacc
cagaaccagaaggcacccctgtgcaatggcagcatggtgtggagtgtcaacctgacagcc
aacatgtactgttcagccctggaagccctgatcaacgtctccaactgcagtgccatccaa
aggacccagaggatgctgaacgcactctgtcttcacaagccctcagctgcggtttccagc
gagcacatccgagacaccaaaattgaagtggcccacttcttaaaagacctgctcaaacat
tcaaggatcatttttcactatggaaaattcagctga

KEGG   Delphinapterus leucas (beluga whale): 111182469
Entry
111182469         CDS       T05885                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle05310  Asthma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182469 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182469 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111182469 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182469 (IL9)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182469 (IL9)
SSDB
Motif
Pfam: Dynamin_M
Other DBs
NCBI-GeneID: 111182469
NCBI-ProteinID: XP_022444565
UniProt: A0A2Y9PFB0
LinkDB
Position
Unknown
AA seq 141 aa
MLLAVVLASALLLCSAASQSCLTLTGIKDVEYLINNLQKHPSSKCNCSTNVTDCSCLPIP
SDTCTSACFQEGLSQMTNTTVKTSFPLIFNRVKKTVEALQNNKCGSFSCEQPCNQTTAGN
MLTFLKTLLESFQKERMRGRV
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctcctggctgtggtccttgcctctgccctactcctctgctctgcggccagccagagc
tgtttgaccttgacagggatcaaggatgtcgagtacctcatcaacaacctgcagaaacat
ccatcttcaaaatgcaactgcagcaccaatgtgactgattgttcgtgtctgcccattcct
tctgacacctgcacctcagcatgcttccaggagggtctgtcgcagatgaccaacaccaca
gtgaaaacaagtttcccgctgattttcaatcgggtgaagaaaacagttgaggccctccag
aacaacaagtgtggatctttttcctgtgaacagccatgcaaccaaaccacagcaggcaat
atgctgacatttctgaagactctcctggaaagtttccagaaagaaaggatgagaggcaga
gtgtga

KEGG   Delphinapterus leucas (beluga whale): 111184604
Entry
111184604         CDS       T05885                                 

Gene name
IL20
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-20
  KO
K22667  interleukin 20
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111184604 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111184604 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111184604 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111184604 (IL20)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111184604 (IL20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 111184604
NCBI-ProteinID: XP_030618078
LinkDB
Position
Unknown
AA seq 231 aa
MGLGCGENKGARTCSTNSYSDPEQAPEAFSSLFLSKLDECARPSENLAPESPVVSRMKGS
GLPLCLLSAVFYVFWTPSARLKTLHLGSCVITTSLQAIRSGFSEIQDRQPKDEIIDLRIL
RKTQPLQDTKPAGQCCRLRHILRLYLDRVFKNXQTPDHRILQKISGLANSFLTIKKDLCL
CHAHMTCPSGEEAMEKYSQLMSHFEELQPQAAVVKALGELDILLSWMEEMD
NT seq 696 nt   +upstreamnt  +downstreamnt
atggggctgggatgcggagagaataaaggagccaggacctgtagcaccaactcatactca
gaccctgaacaagcacctgaagccttctcttctctttttcttagtaagttggatgaatgt
gccagaccatctgaaaatctggctccagaatctcctgtggtctccagaatgaaaggctct
ggtcttcccctctgccttctttctgctgtgttttatgtcttctggacaccttctgccagg
ttgaagacactccatttgggaagctgtgtgatcaccacaagtcttcaggcaattcgaagt
ggattttcagagatacaggacagacaacccaaagatgaaatcattgacctcagaatcttg
aggaagactcagcctttgcaagacacaaagcctgcaggtcagtgctgccgcctccgccat
atactgagactctacctggacagggtattcaaaaactaacagacccctgaccaccgtatc
ctccagaagatcagcggtctcgccaactcttttcttaccatcaagaaggacctctgtctc
tgtcatgcccatatgacatgccctagtggggaggaagcaatggagaaatacagccagctt
atgagccacttcgaagagcttcagcctcaggcagcagtggtgaaggctttgggggagcta
gacattctcctgagctggatggaggagatggactag

KEGG   Delphinapterus leucas (beluga whale): 111184612
Entry
111184612         CDS       T05885                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111184612 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111184612 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111184612 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111184612 (IL19)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111184612 (IL19)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 111184612
NCBI-ProteinID: XP_022448993
UniProt: A0A2Y9Q0Q3
LinkDB
Position
Unknown
AA seq 177 aa
MQAQGVSLCLLGVMLFLCSAHARGLRRCLISMDMRRMEESFRGIKNAIQAKDTFQNVTIL
STSETLHSIKPLDVCCVTKNLLAFYVDRVFKDHQELSPQILRKISSIANSFLHMQKSLQQ
CQERRLCHCRQEATNATRIIHDNYHQLEVRSAAIKSLGELDVLLAWIDKNHQGTSAA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgcaggcacagggtgtttctctctgcctcctgggtgtgatgctctttctgtgctcagcg
catgcccgaggtctcaggagatgtctgatttccatggacatgcgccgtatggaggagagt
ttccgagggatcaaaaacgccattcaagctaaggacaccttccaaaatgtcaccatcctg
tccacatcggagaccctgcacagcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcattttacgtggacagggtgttcaaggaccatcaggagctgagcccccagatc
ttgagaaaaatcagcagcattgccaactctttcctccacatgcagaagagtctacagcaa
tgtcaggagcggaggttgtgtcactgcaggcaggaggccaccaatgcaaccagaatcatc
catgataactaccatcagttggaggtccggtctgctgccattaagtctctgggagagctg
gacgtcttgctagcttggattgacaagaatcatcaaggaacttctgctgcctaa

KEGG   Delphinapterus leucas (beluga whale): 111184747
Entry
111184747         CDS       T05885                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24 isoform X1
  KO
K22668  interleukin 24
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111184747 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111184747 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111184747 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111184747 (IL24)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111184747 (IL24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 111184747
NCBI-ProteinID: XP_022449285
UniProt: A0A2Y9PVQ9
LinkDB
Position
Unknown
AA seq 209 aa
MGSPVRMAALPCLSLILLFWSQGPGVRGQEFQFGPCQVEGVVLQELWEAFQAMKDIVQAQ
DSITGVQLLRKEVLQNASEAESCYLIHALLEFYLNTVFKNYRDKAVEFRILKSFSTLANN
FIVIVSKLQPSQEKEMFSISESAHRRFLLFQRAFKQLDREAAVTKAFGEVDILLTWMENF
YQMGHGAREFPTPGNNRRSITGSGHGAGD
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggctctcctgtgcgcatggctgcccttccctgcctgagtctgatcctgcttttctgg
agccaggggccaggggtccggggccaagaattccaatttgggccctgccaagtagaaggg
gtagttcttcaggaactgtgggaagccttccaggccatgaaggacattgtgcaagctcag
gatagtatcacgggcgtccagctgctgcggaaggaggttctgcagaatgcctcggaggct
gaaagctgctacctcatccatgccctgctggagttctacttgaacactgtcttcaaaaac
taccgcgataaggcagttgaattcaggatcctgaagtcattctctaccctggccaacaac
tttattgtcatcgtgtccaaactgcaacccagtcaggaaaaggagatgttttccatcagt
gagagtgcacacagacggtttctgctgttccagcgagcatttaaacagttggacagagaa
gcagctgtgaccaaagcctttggagaagtggacattctcttgacctggatggagaacttc
taccagatggggcatggagccagggagtttccgacacctgggaacaaccggagaagcatc
actggatctggacatggtgctggtgattga

KEGG   Delphinapterus leucas (beluga whale): 111184748
Entry
111184748         CDS       T05885                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04068  FoxO signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04660  T cell receptor signaling pathway
dle04672  Intestinal immune network for IgA production
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05150  Staphylococcus aureus infection
dle05152  Tuberculosis
dle05310  Asthma
dle05320  Autoimmune thyroid disease
dle05321  Inflammatory bowel disease
dle05322  Systemic lupus erythematosus
dle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111184748 (IL10)
   04068 FoxO signaling pathway
    111184748 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111184748 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111184748 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111184748 (IL10)
   04660 T cell receptor signaling pathway
    111184748 (IL10)
   04672 Intestinal immune network for IgA production
    111184748 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111184748 (IL10)
   05322 Systemic lupus erythematosus
    111184748 (IL10)
   05320 Autoimmune thyroid disease
    111184748 (IL10)
   05321 Inflammatory bowel disease
    111184748 (IL10)
   05330 Allograft rejection
    111184748 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111184748 (IL10)
   05133 Pertussis
    111184748 (IL10)
   05150 Staphylococcus aureus infection
    111184748 (IL10)
   05152 Tuberculosis
    111184748 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111184748 (IL10)
   05144 Malaria
    111184748 (IL10)
   05145 Toxoplasmosis
    111184748 (IL10)
   05140 Leishmaniasis
    111184748 (IL10)
   05142 Chagas disease
    111184748 (IL10)
   05143 African trypanosomiasis
    111184748 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111184748 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111184748 (IL10)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111184748 (IL10)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111184748 (IL10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 111184748
NCBI-ProteinID: XP_022449290
UniProt: A0A2Y9PUU1
LinkDB
Position
Unknown
AA seq 178 aa
MPSSALLCCLIFLARVAAGQHQGTQAKDSCIHFPDSLPHMLRELRAAFSSVKTFFQMNDQ
LDNSLLSQSLLEDFKGYLGCQALSEMIQFYLEEVMPQAEDHGPNIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKSVFNKLQEKGVYKAMSEFDIFINYIEAYMTTKMKN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagctcagcactgctctgttgcctgatcttcctggccagagtggcagccggccaa
caccagggcacccaggctaaggacagctgcatccacttcccagacagcctgccccacatg
ctgcgggagctccgagctgccttcagcagcgtgaagactttctttcaaatgaatgaccag
ctggacaactcgttgttgagccagtctctgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttttacctggaggaggtgatgccgcaggctgaggac
catggccccaacatcaaagagcacgtgaactccctgggggagaagctgaagaccctcagg
ctgcggctgaggcgctgtcatcgatttctgccctgtgaaaacaagagcaaagcggtggag
caggtgaagagtgtcttcaataagctccaagagaagggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaacaaagatgaaaaactga

KEGG   Delphinapterus leucas (beluga whale): 111186103
Entry
111186103         CDS       T05885                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186103 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186103 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111186103 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    111186103 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111186103 (IL21)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111186103 (IL21)
SSDB
Motif
Pfam: IL15 CoV_NSP3_C
Other DBs
NCBI-GeneID: 111186103
NCBI-ProteinID: XP_022452028
UniProt: A0A2Y9Q962
LinkDB
Position
Unknown
AA seq 146 aa
MERIVICLMVLFSGTVAHKSSFQGQDRLLIRLRQLIDIVDQLKNYVNDLDPEFLPAPEDV
KRHCERSAFSCFQKIQLKSANTGDNEKIINVLTKQLKRKLPPTNAGKRQKHKLTCPSCDS
YEKKPPKEFLERLKSLIQKMIHQHLS
NT seq 441 nt   +upstreamnt  +downstreamnt
atggagagaatagtcatctgcctgatggtcctcttctcagggacagtggcccataaatca
agcttccaagggcaagatcgcctcttgattagactgcgtcaacttatagatattgttgat
cagctgaaaaactatgtgaatgacttggaccctgaatttctgccagctccagaagatgta
aagagacactgtgagcggtcggcgttttcatgttttcagaagatccaactaaagtcagca
aataccggagacaatgaaaagataattaatgtattaactaaacagctgaagaggaaacta
cctcccacaaatgcagggaaaagacagaaacataaactgacatgtccttcatgtgattct
tatgagaaaaaaccacccaaagaattcctagaaagactaaaatcactcatccaaaagatg
attcatcagcatctctcctag

KEGG   Delphinapterus leucas (beluga whale): 111186150
Entry
111186150         CDS       T05885                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04151  PI3K-Akt signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04672  Intestinal immune network for IgA production
dle04940  Type I diabetes mellitus
dle05135  Yersinia infection
dle05142  Chagas disease
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186150 (IL2)
   04151 PI3K-Akt signaling pathway
    111186150 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186150 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111186150 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111186150 (IL2)
   04660 T cell receptor signaling pathway
    111186150 (IL2)
   04658 Th1 and Th2 cell differentiation
    111186150 (IL2)
   04659 Th17 cell differentiation
    111186150 (IL2)
   04672 Intestinal immune network for IgA production
    111186150 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186150 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111186150 (IL2)
   05321 Inflammatory bowel disease
    111186150 (IL2)
   05330 Allograft rejection
    111186150 (IL2)
   05332 Graft-versus-host disease
    111186150 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111186150 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111186150 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186150 (IL2)
   05171 Coronavirus disease - COVID-19
    111186150 (IL2)
   05162 Measles
    111186150 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111186150 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111186150 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111186150 (IL2)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111186150 (IL2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Cytokines
   111186150 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 111186150
NCBI-ProteinID: XP_022452137
UniProt: A0A2Y9Q9K4
LinkDB
Position
Unknown
AA seq 154 aa
MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRML
TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS
ETRFTCEYDDETVTAVEFLNKWITFCQSIYSTMT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttgtcttgcattgcactaactcttgcacttgtggcaaacggt
gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat
ttacatttgcttttgaaggaaattaataattacgagaacctcaagctcttcaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca
gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg
atagatatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct
gaaacaagattcacatgtgaatatgatgatgagacagtaaccgctgtagaatttctgaac
aaatggattaccttttgtcaaagcatctactcaacaatgacttga

KEGG   Delphinapterus leucas (beluga whale): 111187740
Entry
111187740         CDS       T05885                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15 isoform X1
  KO
K05433  interleukin 15
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04668  TNF signaling pathway
dle04672  Intestinal immune network for IgA production
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111187740 (IL15)
   04668 TNF signaling pathway
    111187740 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111187740 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    111187740 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187740 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111187740 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111187740 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111187740 (IL15)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111187740 (IL15)
SSDB
Motif
Pfam: IL15 DUF5321
Other DBs
NCBI-GeneID: 111187740
NCBI-ProteinID: XP_022455388
UniProt: A0A2Y9QJ07
LinkDB
Position
Unknown
AA seq 180 aa
MLMTSQETKKSVLEDSKCTGGHKPYLRSTSIQCYLCLLLNSHFLTEAGIHVFILGCIGAG
LPKTEANWQHVISDLKRIEDLIQSIHMDATLYTESNAHPTCKVTAMKCFLLELHVILHES
RNSDINDTVENLIILANSSLSSIEYKTESGCKECEELEEKNIKEFLKSFVHIVQMFINPS
NT seq 543 nt   +upstreamnt  +downstreamnt
atgttgatgacgtcacaggaaacaaagaagtcagtgttagaagatagcaaatgtacagga
ggtcataaaccatatttgagaagtacttccatccagtgctacttgtgtttacttctgaac
agtcattttttaactgaggctggcattcatgtcttcattttgggttgtatcggtgcaggt
cttcctaaaacagaagcaaactggcagcatgtaataagtgatttgaaaagaattgaagat
cttattcaatctatacatatggatgctactttatatactgaaagcaatgctcatcccact
tgcaaagtaacagcgatgaaatgctttctcctggagttacatgtgattttgcatgagtcc
agaaattcagacattaacgatacagtagaaaaccttatcatcctagcaaacagcagttta
tcttccattgagtataaaactgaatcgggatgcaaagaatgtgaggagctggaggaaaaa
aatattaaagaatttttgaagagttttgtacatattgtgcaaatgttcatcaacccttct
tga

DBGET integrated database retrieval system