KEGG   Delphinapterus leucas (beluga whale): 111162810
Entry
111162810         CDS       T05885                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111162810 (YWHAH)
   04151 PI3K-Akt signaling pathway
    111162810 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111162810 (YWHAH)
   04114 Oocyte meiosis
    111162810 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111162810 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111162810 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111162810 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111162810 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111162810 (YWHAH)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111162810 (YWHAH)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111162810 (YWHAH)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111162810 (YWHAH)
SSDB
Motif
Pfam: 14-3-3 DUF722
Other DBs
NCBI-GeneID: 111162810
NCBI-ProteinID: XP_022406713
UniProt: A0A2Y9LN64
LinkDB
Position
Unknown
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTTADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaccgcgagcagctccttcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgccatgaaggcggtgaccgagctcaacgaacctctctccaatgaa
gaccgaaacctcctctccgtggcctacaagaatgtggtcggtgcccggcggtcttcctgg
agggtcatcagcagcatcgagcagaaaaccacggctgacgggaatgagaagaagctggag
aaggttaaggcttaccgggagaagattgagaaggagctggaaacagtgtgcaatgacgtg
ctggccctgctggacaagttcctcatcaagaactgcaatgacttccagtatgagagcaag
gtcttctacctgaagatgaagggcgactactaccgctacctggcagaggtggcttctggc
gagaagaaaaacagtgtggtcgaagcttcagaggcagcctacaaggaagccttcgaaatc
agcaaggagcacatgcagccaacacaccccatccggctgggcctggccctcaacttctcc
gtgttctactacgagatccagaatgcgcccgagcaggcctgcctcttagccaaacaagcc
ttcgatgacgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctcatcatgcagctgctgcgagacaacctcaccctctggacgagcgaccagcaggacgag
gaagccggagaaggcaactga

KEGG   Delphinapterus leucas (beluga whale): 111164449
Entry
111164449         CDS       T05885                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111164449 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    111164449 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111164449 (YWHAQ)
   04114 Oocyte meiosis
    111164449 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111164449 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111164449 (YWHAQ)
   05160 Hepatitis C
    111164449 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111164449 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111164449 (YWHAQ)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111164449 (YWHAQ)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111164449 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 Peptidase_S64 Peptidase_C98
Other DBs
NCBI-GeneID: 111164449
NCBI-ProteinID: XP_022409836
UniProt: A0A2Y9LM78
LinkDB
Position
Unknown
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVWGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctctcggtggcctacaagaacgtggtctggggccgcaggtccgcctggagg
gtcatctcgagcatcgagcagaagaccgacacctccgacaagaagctgcagctgataaag
gactatcgggagaaagtggagtccgaactgcggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaag
atgaagggagattacttccggtaccttgctgaagttgcttgtggtgatgatcggaaacaa
acgatagataattcccaaggagcttaccaagaggcttttgatataagcaagaaagagatg
caacccacacacccaatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataacccagaacttgcctgcacactggctaaaacggcttttgatgaggccatt
gcagagcttgacacactgaatgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacattatggacgtcagacagtgcaggagaagaatgtgatgcggca
gaaggggcagagaactaa

KEGG   Delphinapterus leucas (beluga whale): 111175442
Entry
111175442         CDS       T05885                                 

Definition
(RefSeq) 14-3-3 protein gamma-like
  KO
K16198  14-3-3 protein gamma/eta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111175442
   04151 PI3K-Akt signaling pathway
    111175442
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111175442
   04114 Oocyte meiosis
    111175442
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111175442
  09172 Infectious disease: viral
   05160 Hepatitis C
    111175442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111175442
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111175442
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111175442
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111175442
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111175442
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111175442
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 111175442
NCBI-ProteinID: XP_022430709
UniProt: A0A2Y9N7J7
LinkDB
Position
Unknown
AA seq 153 aa
MVRAYREKIDKELVCQDELVCQDELSLLDKYQIKNCQDGRYESKVLYLNMKGDYYRYLAK
VTTGEKRATFEESSEKTCSEAHEVSKGHTQPAHPIRLGLALNYCLFYYEIRNAKEQACHL
AKTTYNSAIAKLDTLSGDSYRDSTLIMQLLPTT
NT seq 462 nt   +upstreamnt  +downstreamnt
atggtacgtgcttaccgtgaaaaaatagacaaggagctggtgtgtcaggatgagctggtg
tgtcaggatgagctgagcctgctggataaataccagatcaagaattgccaggacggccgg
tatgagagcaaagtgttgtacctgaatatgaaaggggactattaccgctacctggccaaa
gtcaccactggagagaagagggcgaccttcgaggagtcatctgagaagacatgtagcgaa
gcccacgaggtcagcaaagggcacacgcagcccgctcaccccattagattaggcctggcc
cttaactactgccttttctactatgagatccggaatgccaaagagcaagcctgccacttg
gccaagacaacttacaatagcgccattgccaagcttgacactctcagtggagactcctac
agggactccacgctcatcatgcagctcctcccgacaacctaa

KEGG   Delphinapterus leucas (beluga whale): 111179149
Entry
111179149         CDS       T05885                                 

Definition
(RefSeq) 14-3-3 protein gamma-like
  KO
K16198  14-3-3 protein gamma/eta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111179149
   04151 PI3K-Akt signaling pathway
    111179149
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111179149
   04114 Oocyte meiosis
    111179149
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111179149
  09172 Infectious disease: viral
   05160 Hepatitis C
    111179149
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111179149
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111179149
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111179149
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111179149
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111179149
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111179149
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 111179149
NCBI-ProteinID: XP_022438185
UniProt: A0A2Y9NVX9
LinkDB
Position
Unknown
AA seq 246 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYENVVGARRSSW
RAISSIEQKTSADGNEKIEMVRAYREKIEKELEAVCQDVLSLLGNFLIKNCSETQYESRV
FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV
FYYEIQNAQEQACHLAKTAFDDAIAELDTLKEDSYKDSTLIMQLLRDNLTLWTSDQQDDN
GGEGNN
NT seq 741 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggcggagcaggcggagcgctac
gatgacatggccgcagccatgaagaacgtgacagagctgaatgagccactgtccaatgaa
gaaagaaaccttctctctgtggcctacgagaatgtagttggggcacgccgttcttcctgg
agggccatcagtagcattgagcagaagacatctgcagatggtaatgagaagatagagatg
gtccgtgcttaccgtgaaaaaatagagaaggagttggaggccgtatgtcaggatgtgctg
agcctactgggtaacttcctgatcaagaattgcagtgagacccagtatgagagcagagtg
ttttacctgaagatgaaaggggactattaccgctacctggccgaagtcgccactggagag
aagagggcaaccgtcgtggagtcatctgagaaggcctacagcgaagcccatgagattagc
aaggagcacatgcagcccactcaccccattagattaggcctggcccttaactactccgtt
ttctactatgagatccagaacgcccaagagcaagcctgccacttggccaaaaccgctttt
gatgacgccattgccgagctcgacactctcaaggaggactcctacaaggactccacgctc
atcatgcagctcctccgcgacaacctcacgctctggacaagcgatcagcaagacgacaac
ggtggagaaggcaacaattaa

KEGG   Delphinapterus leucas (beluga whale): 111180376
Entry
111180376         CDS       T05885                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111180376 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    111180376 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111180376 (YWHAZ)
   04114 Oocyte meiosis
    111180376 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111180376 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111180376 (YWHAZ)
   05160 Hepatitis C
    111180376 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111180376 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111180376 (YWHAZ)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111180376 (YWHAZ)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111180376 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 111180376
NCBI-ProteinID: XP_022440387
UniProt: A0A2Y9PAR8
LinkDB
Position
Unknown
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaaactggccgagcaggctgagcggtatgac
gacatggcggcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgagcaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgctatttggctgaggttgctgctggtgatgacaagaaaggg
attgtggatcaatcacagcaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
cagccaacacatcctatcagattgggtctggcccttaacttctctgtgttctattatgag
attctgaactcccctgagaaagcctgctctcttgcaaaaacggcatttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacactaataatgcagtta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

KEGG   Delphinapterus leucas (beluga whale): 111182017
Entry
111182017         CDS       T05885                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111182017 (YWHAG)
   04151 PI3K-Akt signaling pathway
    111182017 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111182017 (YWHAG)
   04114 Oocyte meiosis
    111182017 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111182017 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111182017 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111182017 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111182017 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111182017 (YWHAG)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111182017 (YWHAG)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111182017 (YWHAG)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111182017 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 111182017
NCBI-ProteinID: XP_022443733
UniProt: A0A2Y9PLZ7
LinkDB
Position
Unknown
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggcggagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtccaatgaa
gaaagaaaccttctctctgtggcctacaagaatgtagttggggcacgccgttcttcctgg
agggtcatcagtagcattgagcagaagacatctgcagatggtaatgagaagaagatagag
atggtccgtgcttaccgtgaaaaaatagagaaggaattggaggccgtatgtcaggatgtg
ctgagcctgctggataactacctgatcaaaaattgcagtgagacccagtatgagagcaaa
gtgttttatctgaagatgaaaggggactattaccgctacctggccgaagtcgccactgga
gagaagagggcaaccgtcgtggagtcatctgagaaggcctacagcgaagcccatgagatt
agcaaggagcacatgcagcccactcaccccattagattaggcctggcccttaactactcc
gttttctactatgagatccagaacgccccagagcaagcctgccacttggccaagaccgct
tttgatgacgccattgctgagctcgacactctcaacgaggactcctacaaggactccacg
ctcatcatgcagctcctccgagacaacctcacgctctggacaagcgatcagcaagacgac
gatggtggagaaggcaacaattaa

KEGG   Delphinapterus leucas (beluga whale): 111184144
Entry
111184144         CDS       T05885                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha isoform X1
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111184144 (YWHAB)
   04151 PI3K-Akt signaling pathway
    111184144 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111184144 (YWHAB)
   04114 Oocyte meiosis
    111184144 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111184144 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111184144 (YWHAB)
   05160 Hepatitis C
    111184144 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111184144 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111184144 (YWHAB)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111184144 (YWHAB)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111184144 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 111184144
NCBI-ProteinID: XP_022448027
UniProt: A0A2Y9PXF3
LinkDB
Position
Unknown
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaaactcgccgagcaggcggagcgc
tacgatgacatggctgcggccatgaaggcagtcacagagcaggggcacgagctctctaac
gaggagagaaacctgctgtctgttgcctacaagaatgtggtcggtgcccgtcgttcttcc
tggcgtgtcatctccagcatcgaacagaaaacagagaggaacgagaagaagcagcagatg
ggcaaagagtatcgtgagaagatcgaggcagagctgcaggacatctgcaacgatgttctg
gagctgttggacaaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggcgattattttagatatctttctgaggtggcatctggagacaataaa
caaaccactgtgtcaaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgactgggcctggcgcttaacttctccgtcttttac
tatgagattctaaactctcctgaaaaggcttgcagcctggcaaaaacggcatttgacgaa
gcgattgctgaattggacacgctgaatgaagagtcttacaaagacagcaccctgatcatg
cagttgcttagggacaacctcactctgtggacgtcggaaaaccagggagatgaaggagat
gctggggagggagagaactaa

KEGG   Delphinapterus leucas (beluga whale): 111185838
Entry
111185838         CDS       T05885                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04722  Neurotrophin signaling pathway
dle05160  Hepatitis C
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111185838 (YWHAE)
   04151 PI3K-Akt signaling pathway
    111185838 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111185838 (YWHAE)
   04114 Oocyte meiosis
    111185838 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111185838 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111185838 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111185838 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111185838 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111185838 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111185838 (YWHAE)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111185838 (YWHAE)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111185838 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 111185838
NCBI-ProteinID: XP_022451518
UniProt: A0A2Y9Q7R8
LinkDB
Position
Unknown
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggatgtggagttgacagttgaa
gaaagaaacctcctatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
aggataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaagctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacacatcccattcgcttaggtcttgctctcaatttttccgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacgcttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

DBGET integrated database retrieval system