KEGG   Delphinapterus leucas (beluga whale): 111162913
Entry
111162913         CDS       T05885                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04015  Rap1 signaling pathway
dle04062  Chemokine signaling pathway
dle04510  Focal adhesion
dle04666  Fc gamma R-mediated phagocytosis
dle04722  Neurotrophin signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05100  Bacterial invasion of epithelial cells
dle05135  Yersinia infection
dle05163  Human cytomegalovirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111162913 (CRKL)
   04012 ErbB signaling pathway
    111162913 (CRKL)
   04015 Rap1 signaling pathway
    111162913 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111162913 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111162913 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    111162913 (CRKL)
   04062 Chemokine signaling pathway
    111162913 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111162913 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    111162913 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111162913 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162913 (CRKL)
   05206 MicroRNAs in cancer
    111162913 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111162913 (CRKL)
   05211 Renal cell carcinoma
    111162913 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111162913 (CRKL)
   05100 Bacterial invasion of epithelial cells
    111162913 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111162913 (CRKL)
   05163 Human cytomegalovirus infection
    111162913 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111162913 (CRKL)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   111162913 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 111162913
NCBI-ProteinID: XP_022406924
UniProt: A0A2Y9LB74
LinkDB
Position
Unknown
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGVFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPSLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTAPLPAVSSTPGAAVSPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctcggcctggtacatggggcccgtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggcgtgttcctggtccgcgat
tcgtccacctgccccggggactacgtactgtccgtgtccgagaactcgcgggtgtctcac
tacatcatcaactcgctgcccaaccgccgcttcaagatcggggaccaggagttcgaccac
ctgccggccctgctggagttctacaagatccactacctggacaccaccacgctcatcgag
ccggcgcccaggtatccgagcccaccaatgggatctgtatcagcacccagcctgcctaca
gcagaagaaaatctggaatatgtacgaactctctatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagccggaagaacagtgg
tggagtgcccggaacaaggatggccgggtggggatgattcccgtcccttacgtggaaaag
cttgtgaggtcctcgccacacggaaagcatgggaataggaattccaacagttacgggatc
ccagaacctgctcacgcgtatgctcagcctcagaccacggctcctctgcctgcagtttcc
agcactcctggggcagcggtcagccctttgccatccacacagaatggacctgtctttgca
aaagcaattcagaaaagagtgccctgtgcttatgacaagaccgccctggcattagaggtg
ggtgacatcgtgaaagtcacaaggatgaacataaacggccagtgggaaggcgaggtgaat
gggcgcaaagggctcttccccttcacgcacgtcaaaatcatcgaccctcagaacccggat
gaaaacgagtga

KEGG   Delphinapterus leucas (beluga whale): 111185687
Entry
111185687         CDS       T05885                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04015  Rap1 signaling pathway
dle04062  Chemokine signaling pathway
dle04510  Focal adhesion
dle04666  Fc gamma R-mediated phagocytosis
dle04722  Neurotrophin signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05100  Bacterial invasion of epithelial cells
dle05135  Yersinia infection
dle05163  Human cytomegalovirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111185687 (CRK)
   04012 ErbB signaling pathway
    111185687 (CRK)
   04015 Rap1 signaling pathway
    111185687 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111185687 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111185687 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    111185687 (CRK)
   04062 Chemokine signaling pathway
    111185687 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111185687 (CRK)
   04935 Growth hormone synthesis, secretion and action
    111185687 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111185687 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185687 (CRK)
   05206 MicroRNAs in cancer
    111185687 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111185687 (CRK)
   05211 Renal cell carcinoma
    111185687 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111185687 (CRK)
   05100 Bacterial invasion of epithelial cells
    111185687 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111185687 (CRK)
   05163 Human cytomegalovirus infection
    111185687 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111185687 (CRK)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   111185687 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 111185687
NCBI-ProteinID: XP_022451169
UniProt: A0A2Y9PWG4
LinkDB
Position
Unknown
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcaggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagtcgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtttcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaagaggcagagtatgtacgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcccgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system