KEGG   Delphinapterus leucas (beluga whale): 111163020
Entry
111163020         CDS       T05885                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04115  p53 signaling pathway
dle04218  Cellular senescence
dle04914  Progesterone-mediated oocyte maturation
dle05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111163020 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111163020 (CCNB1)
   04114 Oocyte meiosis
    111163020 (CCNB1)
   04115 p53 signaling pathway
    111163020 (CCNB1)
   04218 Cellular senescence
    111163020 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111163020 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111163020 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111163020 (CCNB1)
   03036 Chromosome and associated proteins [BR:dle03036]
    111163020 (CCNB1)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    111163020 (CCNB1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111163020 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP
Other DBs
NCBI-GeneID: 111163020
NCBI-ProteinID: XP_022407114
UniProt: A0A2Y9LBQ6
LinkDB
Position
Unknown
AA seq 433 aa
MALRITRNTKINAENKAKVSMAGAKRVPVATVAASKPGLRPRTALGDIGNKVSEQPQAKL
PLKKEAKTLAAGKVIAKKLPKPLEKAPVPVPEPQPELDLEPEPEPETEPVKEEKLPPEPI
LVDTPSPSPMETSGCAPAEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQDNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKYQIRQMEMKILRALNFSLGRP
LPLHFLRRASKIGEVDVELHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLLVMQHLAKNIIIVNRGLTKHMTIKNKYATSKHAKISILAQLNS
ALVQDLAKAVAKV
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgctccggatcaccaggaacacgaaaattaatgctgaaaataaggcgaaggtcagt
atggcaggcgcaaagcgcgtgcctgtggccactgttgcagcctctaagcccgggctgagg
ccaagaacagcccttggagacatcggtaacaaagtcagtgaacagccacaggccaaattg
cccctgaaaaaggaagcaaaaactttagctgctgggaaagttattgctaaaaaactacca
aaacctctggaaaaggctcctgtacctgtgccagagccccagccggagctggatctggag
ccagagccagagccggaaaccgagcctgttaaagaagagaaacttccccctgagcctatt
ttggttgatactccctctccaagccccatggaaacatctggctgtgcccctgcagaagag
tatctgtgccaggctttctctgatgtaattcttgcagtgaatgatgtggatgcagaagac
ggagcggatccaaacctttgtagtgaatatgtaaaagatatctatgcttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaatacctactgggtcgtgaagtcactggaaac
atgagagccatcctaattgactggctagtgcaggttcaaatgaaattcaggttactccag
gagaccatgtacatgactgtttccattattgatcggttcatgcaggataactgtgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttattgcaagcaaatacgaggaa
atgtaccctccagaaattggtgactttgcctttgtgactgacaacacctacactaagtac
caaatcagacagatggaaatgaagattctaagagctttaaattttagtctgggtcgccct
ctacccctgcatttccttcggagagcatctaagattggagaggttgatgttgagctacat
actttggccaaatatctgatggaactaactatgttggactacgatatggtgcactttcct
ccttctcagattgcagcgggagctttttgcttagcactgaaaattcttgataatggtgaa
tggacaccaaccctacagcattacctgtcatacactgaagaatcccttcttcttgttatg
caacacctggctaagaatataatcatagtgaatcgtgggcttacaaagcatatgactatc
aagaacaagtatgctacgtctaagcatgctaagatcagcattctagcacagctgaattct
gcactagttcaagatttagccaaggctgtggcaaaggtgtaa

KEGG   Delphinapterus leucas (beluga whale): 111169503
Entry
111169503         CDS       T05885                                 

Gene name
CCNB3
Definition
(RefSeq) LOW QUALITY PROTEIN: G2/mitotic-specific cyclin-B3
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04218  Cellular senescence
dle04914  Progesterone-mediated oocyte maturation
dle05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111169503 (CCNB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111169503 (CCNB3)
   04218 Cellular senescence
    111169503 (CCNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111169503 (CCNB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111169503 (CCNB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111169503 (CCNB3)
   03036 Chromosome and associated proteins [BR:dle03036]
    111169503 (CCNB3)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    111169503 (CCNB3)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111169503 (CCNB3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111169503
NCBI-ProteinID: XP_022419493
UniProt: A0A2Y9MQS0
LinkDB
Position
Unknown
AA seq 1456 aa
MPLPLPPQRSRRETKKSQSSKIVPSDHGPSEKREENHQAKISPSSPQGPLKKRSAFEDLT
NASQSQPAKPKKEASNEFVKDVSKKINRNTRARGYNKLELSPVVVSTTMVPNIIDKPFIL
EISTSSKTPTTEKASLFKKPFILKEEPTTEDTILIKRSLKKSTNQRKVSLLEKPLSLQEE
TDSDVVEPVTFGEKHKTEKAAINKSTLSLKNMCTHQGKQSCTREELALQDISVEEDSFFM
EPMNFRKKPKTEEATPTKKLLSLKKKCTTQGKMSCMKKPLVLQKITSEEKSLAKELLSFK
RKPTTEKECLFQEPSALPKKHTTEQEVSILKKSLAFQEKIDTEEDSVFKEPLAFKKQPTT
VETTFTTRPLSLKKKCTTQGKIAHLKKPLVLQKTISGEKALIKESLSFKKKPTTKEESLF
QELSVLQEKHTTDGEVTLLKKPETLQEKKDGEDEFLMEPISSRKKHTTKEATLSKKPLPL
KKKHTTRGKRYRLKKPLVLQKTTSEEKSLIKEPLSLKKTPTTKESLFQEPSALQERHTTQ
EELSILEKPLVLQKTPTAEESLLREALAFNKKRTIEEATSSNKLLSLKKKCTSQGKMSCL
TKPLVLQTISEEKSLIKEPLSFKKKPTTEEESLLKKPSALQEKHTIQGDVVLLKKLWALQ
ENIDSKDEFLMEPVSFRKKHTTDVAVSTKESLSLKKKKCTTQMMMPIFQEQLDLQNMIGE
GEDSSFMEPMSFRKKSSTDETILTKTPVSLKKRQITRGKTFLLKKPLVIEKTTSEEESLF
KELLPFKKKSTTEEFLFQDPSVLKERHTTLQEVFLSEKPLALQENITTEEESYIKEPLTL
QERSTTEEEFPFQEPFSLHVKPTNKDESLFRKSFALQKKTDNKEDSLKALLALQDKSTTE
EEFLFKKPLVLKEELSAEVAVSIEGQLSLKKKPTAQGEVFLLKKQLALQENITIEEESLI
KQPQALQEKPSIEKETILRESLTLQENLTIEEEAILKEPLALQENPSIEKEIILRESLAL
QEKPTSEKETFVEEPLALQENPTIEEEAILKEPLALQEKPSSEKDLSSKEPLALQKNLTH
KEDTFIKDFIILQVETSPLVSTTAPDSRTGLSSTVTVSSVGKFSTTSQSSTCESSSNEPF
SSQDKRSEKEMTPLEDIDKDHSDPFFNSIYAKDIFSYMKEREEKFILKKYMTRQNDINSD
MRAILVDWLVEVQMTFEMSHETLYLAVKLVDHYLMEVICKRDKLQLLGSTAFLIAAKFEE
PSPPCVDDFLYICDDIYKRDEMLAMEISILKTLKFDINIPIAYHFLRRYAKCVHASMKTL
TLSRFICEMTLQEYDYVQERASKLAAGSFLLALYMKKLGHLAPTLEYYSGYKTSDLHPLV
RQLNILLTLRLCNRLKTVHSKYSHQVFFEVTKIPPLDVLKLEEILNCANSEAEGLVLWQQ
PPGPGRRVNKLYLFCP
NT seq 4371 nt   +upstreamnt  +downstreamnt
atgccactgccactaccaccccaacgctccagacgtgagactaagaaatctcagtccagc
aaaattgtgcccagtgatcatggcccatctgaaaagagagaggagaatcaccaagcaaag
atatctccatcttcacctcagggaccactcaaaaagaggtcagcttttgaagatctcacc
aacgcttctcaaagtcaacctgccaagcccaagaaagaagccagtaatgagtttgttaaa
gatgtttccaagaagataaacaggaacacacgtgctcgtgggtataataagctggaactc
tcaccagtagtagtctcaaccaccatggtaccaaatattatagataaaccattcattctg
gagatatctaccagctccaagacacccactactgagaaggcatctcttttcaaaaagcca
ttcattttaaaagaggaacccactactgaggatacaatcctcatcaagaggtcattaaag
aagagcacaaatcagaggaaggtgtccctcttagagaagccactatccttgcaggaggag
actgacagtgatgttgtagagccagtgacttttggggagaagcataaaactgagaaggca
gccatcaacaagagtacattatctttaaagaatatgtgcacacatcaggggaagcagtcc
tgcacgagggaggagttggcattgcaggacatcagtgttgaagaggattctttctttatg
gagcccatgaactttaggaagaagcctaaaactgaggaggcaactcccaccaagaagctg
ttatctttaaagaaaaagtgtaccactcaggggaagatgtcctgtatgaagaagccacta
gtattgcagaagatcacctctgaagagaagtcactcgctaaggagctgttgtcttttaag
agaaagcctaccactgagaaggagtgccttttccaggagccatctgcattgccaaagaag
cacaccactgaacaagaggtgtccatcttgaagaaatcattggcctttcaggagaagatc
gacactgaagaggattccgtctttaaggaaccattggcttttaagaaacaacctaccaca
gtggagacaaccttcaccacaaggccattatctttaaagaagaagtgcactactcagggg
aagatagcccacttgaagaagccattagtattgcagaagaccatctctggagagaaggca
ctcattaaggagtcattgtcctttaaaaagaagcctaccactaaggaggagtccctcttc
caggagctatctgtgttgcaagaaaagcacaccactgacggggaggttacccttttgaag
aagccagagacattgcaggagaaaaaggatggcgaagatgaatttcttatggagccaatt
tcctcgaggaagaagcatactactaaggaggcaaccctttccaagaagccattaccttta
aagaagaagcatactactcgggggaagaggtaccgcttgaagaagccactagtattacag
aagaccacctctgaagagaagtcactcattaaggagccgttatcccttaagaagacgcct
accactaaggagtcccttttccaagagccatcagcattgcaggagaggcacaccactcag
gaggagttgtccatcttggagaagccgttggtcttgcagaagactccaactgcggaggag
tcccttttaagggaggctttggcttttaacaagaagcgtaccattgaggaggcaacctcc
tctaataagctgttgtctttaaagaagaagtgtaccagtcagggtaagatgtcctgtttg
accaagccactagtattgcagaccatttctgaagagaagtcactcattaaggagccatta
tcctttaaaaaaaagcctaccactgaggaggagtccctcttgaagaaaccatctgcactg
caagagaagcacaccattcagggggatgtggtccttttaaagaagctatgggcattgcag
gagaatatagacagtaaagatgaatttcttatggagccagtgtcatttaggaagaaacat
accacagatgtggcagtctctaccaaggagtcattatctttaaagaagaaaaagtgtacc
actcaaatgatgatgcctatcttccaagaacagttggacttgcagaatatgattggtgaa
ggtgaggactcctcctttatggagccaatgtcatttaggaagaagtcttcaactgatgag
acaattctaaccaagacaccggtatctttaaaaaagaggcaaatcactcgggggaagacg
ttcctcttaaagaagccactggtcatagagaagactacctctgaagaggagtcactcttt
aaggagctgttgccctttaaaaaaaagtctacaactgaagagttcctcttccaggatcca
tctgtactgaaagagaggcacaccactctgcaagaggtgttcctctcagagaagccattg
gccttgcaggagaatatcaccactgaagaagaatcatatattaaggagccactgaccttg
caggagaggtctaccactgaggaggaattcccctttcaggagccattttcattgcatgtt
aaacctaccaacaaagatgagtccctcttcaggaagtcttttgccttgcagaagaagact
gataacaaagaggactccttgaaggcactgttggctttgcaggacaaaagcaccactgaa
gaggaattccttttcaagaaaccattggttctgaaggaagagctctccgctgaggtggca
gtgagcatagaagggcaattatctttaaagaagaagcccactgctcagggggaggtgttc
ctcttgaaaaagcagttggccttgcaagaaaacatcaccattgaagaggagtcccttatt
aagcagccacaggccttgcaggagaagcccagcattgaaaaggagaccatcctgagggag
tccttgaccttgcaggagaatctcacaattgaggaggaggctatcctgaaggagcctctg
gccttgcaggagaatcccagcattgagaaggaaatcatcttgagggagtccttggccttg
caggagaagcccacgagtgagaaagagaccttcgtcgaggagcccttggccttgcaggag
aatcccacaattgaggaggaggctatcctgaaggagcccttggccttgcaggagaagccc
agcagtgagaaagacttgtcttccaaggagccattggccttgcaaaagaatctcactcac
aaagaagacacctttatcaaagatttcatcatcctccaagttgaaaccagcccacttgtg
tctaccactgcccctgactctagaacaggcttgtccagcactgtcaccgtgtccagtgtg
ggcaagttcagtaccacaagccagtccagtacttgtgaatccagttccaatgaacctttc
tcatctcaggacaagagatcagagaaggagatgaccccactggaggatattgacaaggac
cacagtgatccatttttcaactcaatatatgctaaggatatcttcagttacatgaaggag
agagaggaaaagttcatacttaaaaaatacatgaccaggcagaatgatatcaacagtgac
atgagggccattctcgtggactggttggtggaggtgcagatgacctttgagatgagtcat
gagaccctgtacttggcagtgaagctggtagatcactaccttatggaggtaatatgcaag
agggacaagctacaactccttggttccactgcttttctgattgcagcaaaatttgaggag
cccagcccaccttgtgtggatgacttcctgtacatctgtgatgatatttataagcgagat
gagatgctcgccatggaaatcagcatcctaaaaaccctcaaatttgatatcaacattccc
atcgcctatcattttctgcgcagatatgctaagtgtgtccatgccagcatgaagacactg
accttatcccgcttcatctgtgaaatgaccctgcaggaatacgactatgtccaggagagg
gcttccaagctagctgctggctccttcctcctggccctctacatgaagaagcttggacac
ttggctcctaccctggagtattacagtggctacaagacctctgatcttcaccccttggtc
aggcagctgaacatcctgctgactttgcgtctgtgcaataggctcaagactgtgcattcc
aagtattcccaccaggtcttctttgaagtcaccaaaatcccacccttggacgtgttgaaa
ctggaggagattttgaactgcgctaattctgaggctgagggtctggtactctggcagcag
ccaccggggccaggcaggcgtgtaaataagctgtatttattctgtccttga

KEGG   Delphinapterus leucas (beluga whale): 111177576
Entry
111177576         CDS       T05885                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2 isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04115  p53 signaling pathway
dle04218  Cellular senescence
dle04914  Progesterone-mediated oocyte maturation
dle05166  Human T-cell leukemia virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111177576 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111177576 (CCNB2)
   04114 Oocyte meiosis
    111177576 (CCNB2)
   04115 p53 signaling pathway
    111177576 (CCNB2)
   04218 Cellular senescence
    111177576 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111177576 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177576 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    111177576 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111177576 (CCNB2)
   03036 Chromosome and associated proteins [BR:dle03036]
    111177576 (CCNB2)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    111177576 (CCNB2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111177576 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF5852
Other DBs
NCBI-GeneID: 111177576
NCBI-ProteinID: XP_022435159
UniProt: A0A2Y9NJF1
LinkDB
Position
Unknown
AA seq 398 aa
MALLRRPTVSTDLENTDTGVNSKPKSHVTIRRAVLEEIGNRVTIRATQVTKKAQNTKVPV
PPTKTTNVNKHLKPTASVKPVQMEVLAPKGPSPTPVDISMKEENLCQAFSDALICKIEDI
DTEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVAIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGHGKWNVKQQYYTGYTENEVLEVMQHMAKNVVKVNEKLTK
FIAIKNKYASSKLLKISTTPQLNSKTIQELASPLLGRS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgcccgacggtgtccaccgatttggagaatactgacacgggagtt
aattctaaacctaaaagccatgtgactatcaggcgggcagttttagaagaaattggaaat
cgagttacaatcagagccacacaagtaactaagaaagctcagaacactaaagtacctgtt
ccacccaccaaaacaacaaatgtcaacaagcacctgaaacctactgcttctgtgaaacca
gtgcagatggaagtgttggctccaaagggtccctctcccacacctgtggatatctccatg
aaggaagagaacctctgccaagctttctctgatgccttgatctgcaaaattgaggatatt
gatactgaagactgggagaaccctcagctctgcagcgactatgttaaggatatctatcag
tatctaaggcagcttgaggttctacaatccataaatccacattttttagatggaagagat
ataaacggacgcatgcgtgccatcctggtggattggctggtgcaagtccactccaagttt
aggctactgcaggaaactctgtacatgtgcgtcgccatcatggaccgatttttacaggtt
cagccagtctctcgtaagaagcttcaactggttgggattacagctctgctcttggcttcc
aagtatgaggagatgttttctccaaatattgaagacttcgtttacatcacagacaatgct
tacaccagttcccagattcgagaaatggaaactctaattctgaaagaactgaaatttgag
ttgggtcgacctttaccactacatttcttaaggcgggcatcaaaagccggagaggttgat
gttgaacagcacactttagccaaatacttgatggaactgactctcattgactacgacatg
gtgcattatcacccttctaaggtggcagcagccgcttcctgcctgtcccagaaggttcta
ggccacggaaaatggaacgtaaagcagcagtattatactggatacacagagaatgaagta
ttggaagtcatgcagcacatggccaaaaatgtagtgaaagtaaatgaaaagttaacgaaa
ttcatcgccatcaagaataagtatgccagcagcaaactcctgaagatcagcacgactccc
cagctgaactcaaaaaccatccaagagcttgcctcacctctgctgggacggtcctag

DBGET integrated database retrieval system