KEGG   Delphinapterus leucas (beluga whale): 111163079
Entry
111163079         CDS       T05885                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1 isoform X1
  KO
K05637  laminin, alpha 1/2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111163079 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111163079 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111163079 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163079 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111163079 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111163079 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111163079 (LAMA1)
   05414 Dilated cardiomyopathy
    111163079 (LAMA1)
   05416 Viral myocarditis
    111163079 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111163079 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111163079 (LAMA1)
   05145 Toxoplasmosis
    111163079 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_N Laminin_I Laminin_II Laminin_G_3 Hepar_II_III
Other DBs
NCBI-GeneID: 111163079
NCBI-ProteinID: XP_022407245
UniProt: A0A2Y9LC60
LinkDB
Position
Unknown
AA seq 3081 aa
MRGGGAGLALLASLLWVAVQGQQRGLFPAILNLASNAHISTNATCGEKGPETYCKLVEHV
PRRAMRNAQCRLCDGSSANPKERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQV
FQVAYVIIKAANAPRPGNWILEHSLDGMEFSPWQYYAVSDTECLTHYNITPRRGPPTYRA
DDEVICTSYYSRLVPLEHGEIHTSLINGRPSSDDLSPKLLEFTSARYIRLRLQRIRTLNA
DLMTLSHRDPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETIKKFQCQCEHNT
CGDSCNRCCPGYRQQPWRPGTVSSGNTCEECNCHNKAKDCYYDENVANQKRSLNTAGQFR
GGGVCIDCLQKTMGINCETCVDGYYRPHRVSPYDDNPCHPCDCDPLGSLSSVCIKNDLHS
DLHRGKWPGQCPCKEGYAGEKCDRCQFGYKGYPACVPCDCNPAGSVNEEPCSEACLCKEN
VEGKHCDRCKPGFYNLEERNPQGCSECFCFGVSDVCDSLSWPISQVKDMSGWLVTDLVSS
SQLRSQQDTLGGRHQISINSSAVVQRLTSQYYWSAPEAYLGNKLTAFGGFLKYTVSYEVP
VETADGDPMSHADVIIKGNGLTLRTQAEGLLLQPYEEHLNVVRLVPEHFRDFHSRREVDR
DQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDTASPNVIDLSLATEVEHCECPQGYA
GISCESCLPGYYRVDGILFGGICQPCECHGHAAECDVHGVCFACQHNTTGDRCERCLPGF
YGLPSRGTPGDCQPCACPLSTASNNFSPTCHLNDGDEVFCDQCAPGYAGDWCERCADGYF
GNPTVPGDSCVPCNCSGNVDPLEARSCDSVTGECLRCLGNTDGPRCERCAYGFYGDAVTA
KNCRACECHGQGSLSAACHPETGLCDCKPHVTGQQCNQCLHGYYGLDTGLGCLPCNCSAS
GSLSDDCTEEGQCRCVPGVAGERCDRCAHGFHAYQDGGCTPCDCAHTQNTCDPESGECVC
PPHTRGAACEGCADGHWGHDPELGCQACNCSSAGSASHHCDVLTGHCQCKPAFGGQTCHQ
CSLGYRDFPDCVACDCDLRGTLADTCGQEQGLCSCAPETGTCSCKENVIGPQCSECQAGT
FALDEADPRGCTPCFCFGLSQLCSEAEGYVRMPVMLGSDQPLLRVVSQSNLKGTTEGVYY
QAPDVLLDAVTVRRHVHTEPFYWRLPGQFQGDQLMAYGSKLRYSVAFYSSSGIGTSNLEP
QVLIKGGRTRKQVIYVDAPAPKNGLRQEQEVGMKENFWKYFNSVSEEPVTRSDFMSVLSN
IEYILIKASYGQGLQQSRISNISMEVGRKAEESHSRREVASLLEKCLCPPGTAGFSCQDC
APGYHRGKLPEGDGRRPRPLLAPCVPCNCNKHSNTCDPETGKCLNCSHNTAGDHCDVCAP
GYYGKVTGSASDCSLCTCPHGLPASFSPTCVLEGDHDFRCDACFPGYEGQYCERCSSGYH
GNPQMPGGTCQRCGCSPHGSVHSDCDRGSGQCVCRPGATGLRCEDCEPRHILVESDCVSC
DDECGGVLLNDMDHVGDAIVSVNLSGIIPVPYGILSNLENTTKYLRDSLLKENIQKELAK
IQLEGVSEQTEDLQRKLDRVLTRSQHVTRATKRILDKSRDLLTFTEKLQADIQEIIERAA
TVNQTLDEDVQLPSSTLQNMQKNITSLLEIIQKRNFLQLHQNATLGLKAAEDLLSQIQKN
YQKPQEELEVLKEAASSLLSRHNSKVQATEELLREAERKTQESSRLLFIVRANLREFNDK
KLRVQEEQNLTSVLIAEGRGLLDAATAPANASGKALAQLEHHRDELLLWTAKIRHHVDDL
VMQMSKRRALDLVYRVEDHATELQRLAGALDSGLGNVSHVSLNATSATHVHSNIRSLIEE
SEKLVKDTLRTERKASVASESLVSNGKAALQRSAEFLKEGNSLSRKHGGIALELSELKNT
AKRFQENADKITKQTNESLLILGAIPEGVRDKGTKIKELATSANQSAMSTLKNVVGLGQK
LLNTSTDLSRVNATLRETEELLRDSSVTTLLAGRKVKDVETQANLLFDRLKPLKMLEENL
SRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNSLTLNVKTSEPDNLL
FYLGSSISADFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPVDDSKWHSIYVTRFGNIGSV
SVKEMSASQKPPPRTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTYFKGCMGEA
FLNGQSIGLWNYIEREGKCHGCFGSPQNEDASFHFDGSGYSVVEKMLRATVTQIIMLFST
FSPNGLLLYLASNGTKDFLSIDLVDGRVRVTVDLGSGPLALTTDRRYNNGTWYKIAFQRN
RKQGLLAVIDAYNTSYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTSKSYV
GCIKNLEISRSTFDLLRNSYGVRKGCILEPVRSVSFLRGGYVELPPKSLSPDSELLATFA
TRNSSGIILAALGQHGEKQGHRQAHKPFFSIMLIEGHIEVHVNPGDGTSLRRALLHAPTG
TYGDGQEHSISLIRTGRIITVQLDETAPVEMKLGPSAESRTISVSNLYIGGVPEGEGTPM
LKMRSSFHGCIQNLIFNMELLDFTSATGYEHVDLDSCLLSKQPKLALHGEDGELPPEPQP
LPSPELCVMDRAPEYVPNAHQFGLAGGSHLVLPFNQLAVRKRLLVQLSIRTFASSGLVYY
MAHQNQVDYATLQLHGGRLHFMFDLGKGRTKVSHPALLSDGQWHTVKTEYFKRKGFMTVD
GQESPMVTTAGDATTLDVEGKLYLGGLPSEYRARNIGNITHSIPACIGEVTVNSKQLDED
SPVSAFAVNRCYAAAQEGTFFEGSGYAALVKEGYKVRSDVNITLEFRTSSENGVLLGISS
AKVDAIGLEIVNGKLLFHVNNGAGRITATYEPSAPNTLCDGKWHTLQANKSKHRVVLIVD
GNAVRAESLHTQSTSADTNNPIYVGGYPADVKQNCLSSQTSFRGCLRKLTLIKGPQVQSY
DFSTAFDLQGVFPHSCPGTES
NT seq 9246 nt   +upstreamnt  +downstreamnt
atgcgtggcggcggtgcggggctggcgctcctggcctcgctgctctgggtcgccgtgcag
ggtcaacagagagggctgttccctgccattctcaaccttgccagcaatgcccacatcagc
accaacgcgacctgcggggagaaggggccggagacatactgcaagctggtggagcacgtg
cccaggagggccatgcgcaacgcccagtgccggctctgcgacggcagcagtgccaacccc
aaagaacgccatcccatatcaaatgccatcgatggcacgaataactggtggcagagtcct
agcatccaaaacgggagagagtaccactgggtcacaatcactctggacttgagacaggtc
tttcaagtcgcttatgtcatcatcaaagctgctaatgcccctcggcctggaaactggatt
ttggagcattctctggatggcatggagttcagcccctggcagtactatgcagttagtgac
acggaatgtttgactcattacaatatcactccaagacgggggccgcccacttacagggca
gatgacgaagtgatctgcacctcctattactccaggctggtgccacttgagcacggagag
attcatacatcgctaatcaatggcagaccaagctctgatgatctttcacccaagttgttg
gaatttacttctgcacgatacatccgcctgcgcttacagcgcattcgaaccctcaatgcc
gatcttatgaccctcagccaccgggaccctaaagacctcgaccctattgtcacaagacga
tattactattcaataaaagacatttctgttggaggaatgtgtatttgttatggccatgct
agtagctgcccatgggatgaaactataaagaaattccagtgtcagtgtgaacataacacg
tgtggtgacagctgcaatcggtgttgtcctgggtaccgtcagcagccctggaggcccggc
actgtttcttctggtaacacgtgtgaagaatgcaattgccacaataaagccaaagactgt
tactatgatgaaaatgtggcgaatcagaagagaagtctgaatactgccggacaattcaga
ggaggaggggtttgcattgattgcctgcagaaaaccatgggcatcaactgtgaaacctgc
gtggatggatattacagaccacacagggtgtcaccttatgatgacaacccttgtcatccc
tgtgactgtgaccctctggggtccctcagttctgtctgtattaagaatgaccttcattct
gacttacacagagggaagtggccgggtcagtgtccatgcaaggaaggttacgcgggagaa
aaatgtgatcgctgccagtttggttataagggttaccctgcgtgtgtgccctgtgactgt
aacccagccggcagcgtgaatgaggaaccctgctccgaggcttgtctctgtaaggagaat
gttgaggggaaacattgtgatcgatgcaaaccaggattctataacttggaggaaaggaac
ccccagggctgctcagaatgcttctgctttggtgtctctgacgtttgcgacagcctctcc
tggccaatcagtcaggtgaaagatatgtccggttggctggtcaccgacttggtcagttcc
agccagctccggtcccagcaggacacgctgggcgggcgtcaccagatcagcatcaacagc
tcggcggtggtgcagaggctgacctcccagtattactggtcggccccggaggcctacctg
ggaaacaagctgacggcctttggtggattcctgaagtacacggtgtcttacgaggtccca
gtggagacggcggacggtgaccccatgtctcacgccgacgtcatcattaaggggaatggg
ctcactttaaggacccaggcagagggcctgttattgcagccctatgaagagcacttgaac
gtggttagactcgtgcctgagcacttcagagattttcatagcaggagggaggtagatcgc
gaccagctgatgaccgtgcttgccaacgtgacacatctcttgatcagagccaactacaat
tctgcaaagatggctctttacaggttggattctgtctctctggacacagccagccctaac
gttatagacctgtccctggccacggaggtggagcattgcgagtgtccccaaggctatgcg
ggcatctcttgtgagtcctgtctccctggctattaccgcgtggatggaatactctttgga
ggaatctgtcagccctgtgaatgccacggccatgcagcagagtgtgacgttcatggcgtt
tgctttgcatgccagcacaacaccaccggggaccgctgcgagcgctgcctgcccggcttc
tacgggctgccttcccgagggacccctggggactgccagccgtgtgcctgcccgctctcc
acggcctccaacaatttcagccccacctgccacctcaacgatggagatgaagtgttctgt
gaccagtgcgccccgggatacgcgggggattggtgcgagagatgtgcagacggttacttt
ggaaacccaacagtgcccggagattcctgtgtcccttgtaactgcagtggcaatgtggac
cccttggaggccaggagctgtgattccgtcaccggagaatgcctgagatgccttgggaac
accgatggcccccgctgtgagaggtgtgcctacgggttctatggggacgccgtgactgcg
aaaaactgccgcgcctgtgaatgccatggccaaggctccctttctgctgcctgccatcct
gagactggactctgtgactgcaaaccacacgtgaccggacagcagtgtaaccagtgcctg
cacggctactacgggttggacacggggctcgggtgcctgccctgtaactgcagtgcatcg
ggctccctgtcggacgactgcacggaggaaggccagtgtcgctgtgtcccaggtgtagct
ggggagaggtgtgacaggtgtgcccacggcttccatgcctaccaggacggtggctgtaca
ccctgtgactgcgctcacactcagaacacctgtgacccggagtcaggggagtgtgtctgc
ccgcctcacactcggggtgcggcgtgcgaggggtgtgcagacggacactggggccacgac
ccggagctcggatgccaggcctgcaactgcagtagcgcggggtcagccagtcatcactgc
gatgtgctcactggccattgccaatgtaagcctgcatttggtggacagacctgccatcag
tgctccctggggtacagagactttccggactgtgtggcctgtgactgcgacctgagaggg
acactggccgacacctgtggccaggagcagggtctctgcagctgtgccccggagaccgga
acctgctcttgcaaggaaaatgtcattggccctcaatgcagtgagtgtcaagctggcacc
tttgctctggacgaggcggaccctcgggggtgcaccccatgcttctgctttgggctgtca
cagctctgctccgaggccgagggctacgtgagaatgccggtaatgctgggctcagatcag
cctcttctgcgtgtggtttctcagagtaacctcaagggtacgaccgagggggtgtattac
caggcccctgatgtcctcctggatgccgtgaccgtcaggcggcatgtccacacagagccg
ttttactggcggctgcccgggcaatttcagggagaccagctcatggcctacggcagcaaa
ctacggtacagcgtggccttctactcttccagtgggatcggcacctccaacctggagcct
caggtgctcatcaaaggaggccggaccagaaagcaagtcatctatgtggacgcgcccgcc
cccaagaatggactgagacaagagcaggaagtggggatgaaagagaatttttggaagtac
tttaactctgtttctgaagaacctgtcacacgttcagattttatgtctgttcttagcaac
attgagtacatcctcatcaaagcatcttatggccaaggattacagcaaagcagaatctca
aatatttctatggaggttggcagaaaggctgaagagtcgcactccaggagggaggtggca
tcccttttagagaagtgtctctgtcctcctggcacagctggattctcatgtcaggactgc
gcacctggttaccacagagggaagcttccagaaggtgatggcaggagaccacgccctctg
ctggctccctgtgtgccttgcaattgcaacaaacacagtaacacctgtgaccctgaaacg
gggaagtgtctgaactgcagccacaacaccgccggagaccactgcgatgtgtgtgccccc
ggctactacgggaaggtgaccggctcggccagcgactgctctctctgcacctgtcctcac
ggcctccctgccagttttagtcccacttgtgtcttggaaggtgatcacgatttccgctgt
gatgcctgttttccgggctacgaaggacaatattgtgaaaggtgctcctcgggctaccat
gggaaccctcagatgccgggcggcacctgccagaggtgtggctgcagcccgcatggctct
gtccacagtgactgtgaccgcgggtccgggcagtgcgtctgcaggccgggggccacgggg
ctccgctgtgaggactgtgaaccaaggcacattctggtggagagcgactgtgtgtcctgt
gacgatgaatgtggaggcgtgctgctgaatgacatggaccatgtgggtgatgccatcgtc
tctgtgaacctctccggcatcatccctgtcccgtatgggattttgtcaaacctggaaaat
acaacgaaatatctccgggactctttattaaaagaaaatatacagaaagaactggcaaaa
attcagcttgaaggtgtctcagaacaaacagaggacctgcaaaggaagctggacagagtg
ttaacacggagccagcacgtgaccagggccaccaaaaggatcctcgacaagagtcgtgac
ctcctgacgtttacggagaagctgcaggcagacatccaagaaatcatcgaaagggcagca
actgtaaatcagaccttggatgaagatgtccagttacccagttctactcttcagaatatg
caaaagaacatcacttcattgctggaaatcattcagaaaaggaatttcctgcagttgcac
caaaatgccactcttggactcaaggctgctgaagatttattgtcacaaattcagaaaaat
taccagaaaccacaggaagagttggaggtattaaaagaagcagcaagcagcctcctttca
agacacaacagtaaagtgcaggccacagaagagctcctgagagaagcagagaggaagacc
caggaaagcagtcgcctgctgttcattgtcagggccaacctgcgagagttcaacgataaa
aagctgcgtgttcaagaagaacaaaacttgacgtcagtgctaatcgctgaaggaagagga
ctgcttgatgctgccactgcacctgcaaatgcttcaggaaaggctctagcacagttagag
catcaccgggatgagctgcttctatggactgccaaaatcaggcaccacgtagatgacctg
gtcatgcagatgtccaaaagaagagcattggacctcgtctacagagtggaggatcatgcc
actgagctccagagactggcaggtgctctggacagtggccttggaaatgttagtcatgtg
tccctaaatgcgaccagtgcaacccatgtccattccaacatccggagcctgattgaagaa
tcagagaagttggtgaaagatactctcaggactgaaagaaaggcaagcgtggcctcagaa
tctcttgtttctaatgggaaagcggctctccagcgcagcgctgaatttctaaaagaaggc
aatagcctgagcagaaagcatggaggtatcgcgttggaactgagtgaattgaaaaatact
gcaaagagatttcaagagaatgctgataaaattactaagcagaccaatgaatcactcttg
atacttggagcaattcctgaaggtgtcagagacaaaggcacaaaaatcaaagagctggcc
acatctgcaaatcagagcgctatgagcactctaaagaacgtcgtgggattgggccagaag
ctgttgaatacgtccactgacctgtccagggttaatgccacgttacgagaaacagaagaa
ctcctccgtgactcctcagtgaccactttgttggctggaagaaaagtcaaagatgtggaa
acacaagcgaaccttttatttgatcggctgaagcctttgaagatgttagaagagaacctg
agcagaaacctatcagaaatcaaactgctgatcagccaggcccggaagcaagcagcgtct
atcaaagttgccgtgtctgcagacagagactgtatccgggcctaccagcctcagatttct
tctaccaactataacagcttaacactaaatgtgaagacaagcgaacctgacaaccttctc
ttctacctggggagtagcatcagtgctgacttcctggcagtggagatgcggcgagggaaa
gtggccttcctctgggatttgggctccgggtccacacgtttggaatttccagacttcccg
gttgatgacagcaaatggcacagtatctatgtaaccaggtttggaaacattggttcggtg
agtgtaaaggaaatgagcgcatctcaaaagccaccaccaagaacaagtaaatcccctgga
acagctaatgttctggatgtaaacaattcaacactaatgtttgttggagggcttggagga
cagatcaagaagtctcctgctgtgaaggttacttattttaaaggctgcatgggagaggcc
ttcttgaatggacagtcgattggcctatggaactatattgaaagggagggaaaatgccat
ggctgctttggaagcccccaaaatgaagatgcttccttccattttgatgggagtgggtac
tctgtcgtggagaagatgctccgggctactgtgacgcagataattatgctttttagtacc
ttttcccctaatgggctgcttctctacctggcttcaaatggcaccaaagactttttatcc
atcgacttggtcgacggcagagttagagttacagttgacctgggttctgggcctcttgct
cttactaccgacagacgctataataatggaacctggtacaaaattgctttccagcgaaac
agaaagcaaggactcctagcagttattgatgcatataacaccagctacaaagaaaccaag
caaggggaaactccaggagcatcttctgacctcaatcgtctagataaggatccaatttat
gtgggtggattacctaggtcaagagttgtaaggagaggtgtcaccagcaaaagctacgtg
ggctgtatcaaaaacctggaaatatctagatcgacctttgatttactcagaaattcctac
ggagtgagaaaaggctgtatactggagcctgtccgaagcgttagcttcttgagaggcggc
tacgttgaattgccacccaagtccttgtcaccagattcggaattgttggcaacatttgcc
accaggaacagcagcggcatcatcctggctgccctgggccagcatggggagaagcaaggt
caccggcaggcccacaagcccttcttttccatcatgctaattgaaggccacattgaagtg
catgttaatcctggggatggaaccagcctgagaagagctctcctgcatgctcccacgggc
acatatggcgacggtcaagagcattccatctccttgataaggaccgggagaattatcact
gtccaactggatgagacagctcctgtggaaatgaagctgggcccatcagcagaaagcagg
acaataagtgtgtccaacctgtacataggtggtgttccagagggcgaggggacacccatg
ctgaagatgagaagctcattccatggctgtatccaaaacctgatctttaacatggaactt
ttggatttcactagtgccactggctatgaacacgtggacttggactcctgcttgctctca
aaacagccaaagctggctctccacggagaggacggcgaactcccgccagagccccagcct
ttaccaagtccagaattgtgtgtcatggacagagccccggagtacgtccccaacgcccac
cagttcggcctcgcaggaggcagccacttggtgctgccctttaatcagctggctgtcaga
aagaggctcttggtccagctaagcatccgaacgttcgcctccagtggcctggtttactac
atggctcatcagaaccaggttgactacgccacgctccagctgcatgggggccgcctccac
ttcatgttcgatcttgggaagggcaggacaaaagtctcacaccctgcgctgctcagtgat
ggccagtggcacacggtcaagacagagtactttaaaaggaagggcttcatgacagttgat
ggccaggaatcgcccatggtgaccacggcgggagatgctaccacgttggatgtggaagga
aagttgtacctaggaggccttccctccgagtacagggccaggaacattggaaatatcacc
cacagcatccccgcttgcattggggaggtgacagtgaacagcaaacagctggacgaggac
agcccagtgtctgcgtttgcagtaaacaggtgctatgcagcagcccaggaaggaactttc
tttgaaggaagtgggtatgcagcccttgtcaaagaaggctacaaagtacgatcagatgtg
aacattacgctggagtttcgtacctcctcagagaatggtgtcctcctggggatcagcagt
gccaaagtggatgccatcggattagagattgtaaatggcaagctcttgtttcacgttaac
aatggtgctggtaggataacagccacatacgaacccagtgctcccaatactctctgtgat
ggaaaatggcacacacttcaggcaaacaaaagcaaacatcgcgtggttctgattgtcgat
gggaatgcagttcgagctgaaagtctacacacccagtctacctctgctgacaccaacaat
cccatttatgttggtggctatcctgctgatgtaaagcaaaactgcctgagcagccagacc
tccttccggggctgtttgcgaaaactcactctaattaagggcccacaagtgcaatcctat
gacttcagcacagcttttgacctacaaggagttttccctcattcctgtcctgggactgag
tcctga

KEGG   Delphinapterus leucas (beluga whale): 111164771
Entry
111164771         CDS       T05885                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha-4 isoform X1
  KO
K06241  laminin, alpha 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05143  African trypanosomiasis
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111164771 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111164771 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111164771 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164771 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111164771 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111164771 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111164771 (LAMA4)
   05145 Toxoplasmosis
    111164771 (LAMA4)
   05143 African trypanosomiasis
    111164771 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3
Other DBs
NCBI-GeneID: 111164771
NCBI-ProteinID: XP_022410365
UniProt: A0A2Y9LLR1
LinkDB
Position
Unknown
AA seq 1824 aa
MALSSAWYAVLPLWLLWGAACSRAASGDDSASPFDIEGSSAVGQLDPPETIEARVALGSL
PPAAKKCDAGFFFAQSGECLPCDCNGNSNECLDGSGLCVHCQRNTTGEHCEKCLDGYIGD
AIRGAPRVCQPCACPLPHVANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLPNTTGFKCEHCAPGYYGDARRAKNCAV
CSCGGGPCDSVTGECLGEGSEPPTGMDCPTISCDKCIWDLTDDLRLAALSIEESKSGLLS
VSSGAAAHRHVNEINSTIYLLKTKLSERENQYILRKIQINNAENTMKSLLSDVEELAGRE
SQATRKSQLAQKESMDTINHATQLAEQAHVVRDKIQEINNKMLYYGEDRELSPEEISEKL
VLAQKMLEEIRRRQPFLTQRELVDEEADEAYELLSQAESWQRQYNDTHSLFPVVLEQLDD
YNAKLSDLQESLDLALDHIRDAEDMNRATAARQRDHKKQHDRVREQMAGVNESLRMSSDS
LTMPRMILSELDDIIKNASGIYAEIDGAKNELQRKLSNLSNLSHDLVQEAVDHAQNLQQE
ADELSRNLHSSDVNGLVQKALDASNVYENIANYVSEANEMAEQALNITDRIYDAVSGIDT
QIIYHKDESENLLSQARELQARANSSNDKAVADTSRRVGGALARKSALKNRLNDAIKRLQ
ATERGDAQQRLGQSKLITAEANKTTMEVQQAAAPMANSLTNWSQNLQHFDSSAYNTAVDF
ARDAVGNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHPKARMDDLKTFTSLSLYMKPPPVKQPELGGTADQFVLYLGSKNAKKEYMGLAI
KNDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEK
FIKKGEFAGDDSLLDLDPEDTVFYVGGVPSNFKLPASLNLPGFVGCLELATLNNDVISLY
NFKHIYNMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEV
RTPADNGLVLLMVNGSMFFSLEMRNGYLHVSYDFGFSNGPVHLEDTMKKAQINDAKYHEI
SIIYHNDKKMILVVDRRHVKSMDNEKMKVPFTDIYIGGAPPEILESRTLRVHLPLDINFR
GCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEG
GFNFRTLQPNGLLFYCASGSDVFSISLDNGTVIMDVKGIKVQSADKQYNDGLSHFIITSV
SPARYELIVDKSRLGSKNPTKGKVEQTQADEKKFYFGGSPISPQYANFTGCISNAYFTRL
DRDVEVEDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPETSQKKKGEKSKDAPSW
DPVGLKFLERNVPRDSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGEKSQFSIRL
KTRSSHGMIFYVSDQEENDFMALFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFI
REKSSGRLIIDGLRVLEESLPPTGATWKIKGPIYLGGVAPGKAVKNVQINSVYSFSGCLS
NLQLSGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPR
SSSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTLVTPKQSLCDGRWHRITVIRD
SNVVQLDVDSEVNHVVGPLNPKPVDQREPVFVGGVPESLLTPRLAPGRPFTGCIRHFVID
GRPVSFSKAALVSGAVSINSCPAA
NT seq 5475 nt   +upstreamnt  +downstreamnt
atggctttgagctcagcctggtacgcagtcctgcctctgtggctcctctggggcgccgcc
tgctcccgcgccgcgtctggggacgacagcgcttctccttttgacattgaagggagctca
gcggtcggccaactagacccgcctgagaccatcgaggcccgcgtggctctcggaagccta
ccgcctgctgccaagaaatgcgacgcaggattcttttttgcccagtcgggagaatgtttg
ccctgtgactgtaatggtaattccaacgagtgcttggatggctctggactttgtgtgcac
tgccaacggaacacaacaggcgagcactgtgagaaatgtctggatggttatatcggagat
gccatcaggggagcaccccgcgtctgccagccgtgcgcctgccccctgcctcatgttgcc
aattttgcagaatcctgctataggaaaaatggagctgttcggtgtatttgtaaagaaaac
tatgctggacctaactgtgaaagatgtgctcctggttactatggaaaccccttgctgatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcagatcctaacctgatctttgaa
gactgtgatgaggtcactggccagtgtaggaattgcttacccaacaccaccggattcaag
tgtgaacactgcgcacctggctactatggggatgccaggagagccaagaactgtgcagtg
tgcagttgtgggggaggcccatgcgacagcgtaaccggagaatgcttgggagaaggttct
gaaccccctacaggcatggactgcccaaccataagctgtgataagtgcatctgggatctg
actgatgaccttcggttagcagcgctctccattgaagaaagcaaatctggtctgttgagt
gtgtcatctggtgccgctgctcataggcatgtgaatgaaatcaactccaccatctacctc
ctcaaaacaaaattgtcagaaagagaaaaccagtatatcctaagaaagatacaaatcaac
aatgctgaaaacacaatgaaaagccttctgtctgacgtggaggaattagctggaagggaa
agtcaagccacaagaaagagccagttggctcagaaggaaagcatggataccattaaccac
gcaactcagcttgcagagcaagcccatgttgtgagggataaaatccaagagatcaacaac
aagatgctctattatggggaagatcgggaacttagccctgaggaaatctctgagaagctg
gtgttggcccagaagatgcttgaggagatccgacgccgtcaaccgttcctcacccaacgg
gaacttgtggatgaagaggcagacgaagcctatgaattgctgagccaggctgagagttgg
cagcggcagtacaacgatactcactctctgtttcctgtggtcctggagcagctggacgac
tataatgctaaattgtcagacctccaggagtcacttgacctggcccttgaccatatcagg
gatgccgaagacatgaacagagccacagcagccaggcagcgggatcacaagaaacagcat
gacagagtgagggaacagatggcaggggtgaacgagtctctgaggatgtcttccgactca
ctgacaatgcctcggatgatcctttcagaacttgatgacataataaagaatgcatcaggg
atttatgctgaaatagatggagccaaaaatgaactacaaagaaaactatccaacctaagc
aacctcagtcatgatttagttcaggaggctgttgaccatgcacagaaccttcaacaagag
gctgatgaattgagcaggaatttgcacagttcagatgtgaatgggctggtacagaaggct
ttggacgcttcaaatgtctatgaaaatattgccaattatgttagtgaagccaacgaaatg
gcagaacaggctttgaacatcactgatcgaatttatgatgctgtgagtgggattgatacg
caaatcatttaccataaagatgagagtgagaacctcctcagtcaagccagagagctgcaa
gcaagggcaaattctagcaatgacaaggcagtggctgacaccagtaggcgcgtgggtgga
gccctagcaaggaagagtgccctcaaaaacagattaaatgatgccattaagagactacaa
gccacagagagaggtgacgctcagcagcgcctgggtcagtccaagctgatcaccgcggaa
gctaacaagaccacaatggaagtccagcaggcggccgccccgatggctaacagtctaacc
aactggtcacagaatcttcaacattttgactcatctgcttacaacactgcagtggacttt
gccagagatgcagttggaaatctgacagaggttgtccctcagctcctggatcagcttcgc
acggtagagcagaagcggcctgcaagcaacgtttctgccagtatccagaggatccgagag
ctcattgctcagaccagaagcgttgccagcaagatccaagtctccatgatgtttgatggt
cagtcggcagtcgaagtgcatcccaaagccagaatggatgacttaaagacctttacgtcc
ctgagcctgtacatgaagcctcctcctgtgaagcaaccagagctgggtgggactgcagat
cagttcgtcctatacctcggaagcaaaaacgccaaaaaagagtacatgggtcttgcaatc
aaaaatgataacctggtgtacgtttataatttgggaactaaggatgtagagattcccctg
gactccaagcctgtcagttcctggcctgcttacttcagcattgtcaagattgaaagggta
ggaaaacacggaaaggtgtttttaacagtcccaagtctaagtagcaccgcagaagaaaag
tttattaaaaagggggaatttgcgggagatgactccttattggatctggatcctgaggac
actgtgttttatgttggtggcgtgccttcaaacttcaagctccctgccagcttaaacctg
cctggcttcgttggctgcctggaattggccactttgaacaatgatgtgatcagcttgtac
aactttaagcacatctataatatggatccctccaaatcagtgccctgtgccagagataaa
ctggcctttactcagagtcgggctgccagctattttttcgatggttctagttatgccgtg
gtgagggatatcacaaggagagggaaattcggtcaggtgactcgctttgacatagaagtt
agaacaccagctgacaacggccttgtgctcctgatggtcaatggaagtatgtttttcagc
ctggaaatgcgcaatggttacctacatgtgtcctatgactttgggtttagcaacggccct
gtgcatcttgaagacacaatgaagaaagctcaaattaatgatgcaaaataccatgagatc
tcaatcatttaccacaatgataagaaaatgattttggtagttgacagacgacatgtcaag
agcatggacaatgaaaagatgaaagtaccttttacagacatatacattggaggagctccc
ccagaaatcttagaatcaaggaccctaagagtacaccttcccctggatatcaatttcaga
ggatgtatgaagggtttccagttccaaaagaaagatttcaatttattagaacagacagaa
accctgggagttggttatggatgcccagaagactctcttatatctcgcagagcatatttc
aatggacagagtttcattgcttcaattcagaaaatatcttttttcgatggctttgaggga
ggttttaatttccgaacattacagccaaatgggttactgttctattgtgcttcagggtca
gacgtgttctccatttcattggataatggcactgtgatcatggatgtaaagggaatcaag
gtgcagtcggccgataagcagtataatgacgggctgtcccacttcatcattacctctgtc
tcccctgcaaggtatgaattgatagtagataaaagcagacttgggagtaagaaccctacc
aaaggaaaagtggaacagacacaagcagatgaaaagaagttctacttcggtggctcaccc
atcagtccccagtatgctaatttcactggctgtataagcaatgcctactttaccaggttg
gatagagatgtggaggtcgaagatttccagcggtattctgaaaaggtccatacttctctt
tatgagtgtcctattgagtcttcgccattgtttctccttcacaaaaaaggaaaaaattcc
tcaaagcctgaaacaagtcagaaaaaaaagggagagaaaagcaaagatgctccttcatgg
gatcctgttggcctgaaattcctagagaggaatgttccaagagactctcactgccacctt
tccaacagccctagagcaatagagcacgcctatcagtacggagggacagccaacagccgc
caagagtttgaacacttaaaaggagattttggtgaaaaatcccagttttccattcgtctg
aaaacacgttcctcccatgggatgattttctatgtctcggatcaagaagagaatgacttc
atggctctcttcttagcccacggccgcttggttttcatgtttaatgttggccacaagaaa
ctgaagattagaagccaagagaaatacaatgatggtttgtggcatgatgtgatatttatt
cgggaaaagagcagcggccgactgataattgatggtcttcgagtcttagaagaaagtctt
ccccctactggagctacctggaaaatcaagggtcctatttatctgggaggtgtggctcct
ggaaaggctgtgaaaaatgtccagataaactcagtctacagcttcagtggctgcctcagc
aatctccagctcagtggggcctctatcacctctgcttctcagacatttagcgtgactcct
tgttttgaaggcccaatggaaacaggaacatacttttcaacagaaggaggatacgtggtt
ctagatgagtctttcaatattggattgaagtttgagattgcatttgaagtccgtcccaga
agcagttctggaacccttgttcacggccacagtgtcaatggggagtacctaaatgttcac
atgaaaaatgggcaggtcatagtgaaagtcaataatggtatcagagacttttccacctta
gtgacacccaagcagagcctctgtgatggcagatggcacagaattacagttattagagat
tcaaatgtggttcagttggatgtagactctgaagtgaaccatgtggttggacccctgaat
ccaaaaccagttgatcaaagggagcctgtgtttgttggaggtgttccagagtctctactg
acaccacgcttggcccctggcagacccttcacaggctgcatccgtcactttgtgattgac
gggcgcccagtgagcttcagtaaagcagccctggtcagcggtgccgtgagcatcaactcc
tgtccagcagcctga

KEGG   Delphinapterus leucas (beluga whale): 111165780
Entry
111165780         CDS       T05885                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04974  Protein digestion and absorption
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111165780 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111165780 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111165780 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111165780 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    111165780 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165780 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111165780 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111165780 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111165780 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111165780 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111165780 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111165780 (COL4A5)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111165780 (COL4A5)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111165780 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 111165780
NCBI-ProteinID: XP_022412451
UniProt: A0A2Y9LUN9
LinkDB
Position
Unknown
AA seq 1685 aa
MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGSDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGFPGPPG
IQGPAGPTGIPGPIGPLGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDQGPPGPPGIRGPPGPPGGVKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDIGPTGPPGLVIPRPGTGVTVGEKGN
IGLPGLPGEKGERGFPGIQGPPGLPGPPGLAVTGPPGPPGFPGERGQKGDEGPPGISIPG
SPGLDGQPGAPGLPGPPGPPGPHIPPSDEVCEAGPPGPPGSPGDRGLQGEQGVKGDKGDT
CFNCIGTGVSGPPGEPGLPGLPGPPGSLGFPGQKGEKGHAGVTGPKGLTGIPGAPGAPGF
PGPKGEPGDILTFPGMKGDKGDLGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGIAFKG
ERGPPGNPGLPGLPGNRGPMGPLGFGPPGPPGEKGIQGVAGNPGQPGIPGPKGDPGQTIT
QPGKPGLPGNPGRDGEVGLPGEPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGVPGTPGRIGLEGPSGPPGFPGLKGEPGFGLPGPPGPPGLPGFKGILGPKGDRGFP
GPQGPPGQAGLDGLPGPKGDIGPNGQPGTMGPPGLPGTGVQGPPGPPGIPGPIGQPGLHG
IPGEKGDPGPPGFDVPGPPGERGSPGIPGAPGPMGPPGSPGLPGKAGASGFPGAKGEMGM
MGPPGPTGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGLPGPMDPDLL
GSKGEKGDPGLPGIPGVAGPKGYQGLPGDPGQPGLSGQPGLPGPSGPKGNPGLPGKPGLT
GPPGLKGNIGDMGFPGPQGAKGSPGPPGVPGQSGSPGLPGQKGEKGDPGISGIGLPGLPG
PKGEPGLPGYPGNPGIKGAMGDTGLPGLPGTPGAKGQPGLPGFPGTPGLPGPKGINGPPG
NPGLPGEPGPVGGGGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGLQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGLPGPEGPRGLPGIGGIKGERGNPGQPGQPGLSGLKGDQGPPGLQGNPGRPGLNGMK
GDPGLPGVPGFPGMKGPSGEPGSTGPEGDPGLIGPPGPPGLPGPSGQSIVIKGDAGPPGV
PGQPGLKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGAGGHKGDPGLPGQPGIRGLDGP
PGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTIQVYEGFSLLYVQGNKRAHG
QDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMEPLKGQSIQPF
ISRCAVCEAPAVVIAVHSQTIQIPRCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSC
LEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQV
CMKRT
NT seq 5058 nt   +upstreamnt  +downstreamnt
atgaaactgcgtggagtcagcctggctgccggcttgttcttactggccctgagtctttgg
gggcagcccgcagaggctgcggcttgctatgggtgttctccaggatcaaagtgtgactgt
agtggtataaaaggagaaaagggggagagaggatttccaggtttggaaggccatccaggt
ttgcctggatttccaggtccagaagggccgccagggcctcggggacaaaagggtagtgat
ggaattccagggccaccaggaccaaaagggatcagaggtcctcctggacttcctggattt
ccagggacaccaggtcttcctggaatgccaggccatgatggggccccaggacctcaaggt
atccctggatgcaatggaaccaagggagaacgtggatttccaggcagtcccggttttcct
ggtttacagggtcctccaggacctcctgggatcccaggtatgaagggagaaccaggaagt
ataattatgtcatcactgccagggccaaagggtaatccaggatttcccggtcctcctgga
atacaaggcccagctggtcccactggtataccagggccaattggtcccctaggaccacca
ggtttgatgggccctcctggcccaccaggacttccaggaccaaaggggaatatgggctta
aatttccagggacccaagggtgagaagggtgagcaaggtcttcagggcccccctgggcca
cctgggcagatcagtgaacagaaaagaccaattgatgtagagtttcagaaaggagatcag
ggacttcctggtgaccaagggcctcctggacctccagggatacgtggtcctccaggtcct
ccaggtggtgtgaaaggtgagaagggtgagcaaggagagcctggcaaaagaggtaaaccg
ggcaaagatggagagaatggccaaccaggaattccaggtttgcctggtgatcctggttac
cctggtgaaccaggaagggatggagaaaagggccaaaaaggtgacattggcccaactggg
cctcctggacttgtgattcctaggcctggaactggtgtaactgtaggagaaaaaggaaac
attgggttacctggcttgcctggagaaaaaggagagcgaggatttcctggaatacagggt
ccacctggccttcctggacctccaggacttgcagttacaggtcctcctgggccccctggc
tttcctggggaaaggggccagaaaggtgatgaaggtccacctggaatttccattcctgga
tctcctggacttgatggacagcctggggctcctggccttccagggcctcctggccctcct
ggccctcacatccctcctagtgatgaggtatgtgaagcaggccctcctggccctccagga
tctccaggtgatagaggactccaaggagaacaaggagtgaaaggtgacaaaggtgacacc
tgcttcaactgtattggaactggtgtttcagggcctccaggtgaacctggtttgccaggt
cttccaggtcccccaggatctcttggtttccctggacagaagggtgaaaaaggacacgct
ggtgtaaccggtcccaaaggattaacaggcataccaggagctccaggcgctccaggcttt
cccggacctaaaggtgaacctggtgacatcctcacttttccaggaatgaagggtgacaaa
ggagatttgggttctcctggagctccagggcttcctggtttacctggcacccctggacag
gatggattgccagggcttcctggccccaaaggagaacctggtggaattgcttttaagggt
gaaagaggtccccctgggaacccaggtttgccaggtctcccaggaaatagggggcctatg
ggccctcttggttttggccctccaggcccaccaggtgaaaaaggcatacaaggtgtagca
ggaaatccaggccagccaggaataccaggtcctaaaggtgatccaggtcagaccataaca
cagccagggaagcctggcttgcctggtaacccaggcagagatggtgaagtaggtcttcca
ggtgaacctggactcccaggccagccaggcttgccaggtatacctggtagcaaaggagaa
ccaggtatccctggaattgggcttcctggaccacctggtcccaaaggtttccctggaatt
ccaggacctccaggagtacctgggacacctggaagaattggtctagaaggtccttctggg
ccaccaggctttccaggactaaagggagaaccaggatttgggctacctgggccacctggg
cctccaggactcccaggtttcaaaggaatacttggtccaaaaggggatcgtggtttccca
ggacctcaaggtcctccaggacaagctggcttggatgggctacctggaccaaaaggtgac
attggaccaaatggacaacctgggacaatgggacctcctgggctgccaggaacaggtgtt
cagggaccaccagggccaccaggaattcctggaccaataggtcaacctggcttgcatgga
ataccaggagagaagggggatccagggcctcctggatttgatgttccaggaccccctggt
gagagaggcagtccagggatccctggagcaccaggtcctatgggacccccaggatcacca
gggctcccaggaaaagcaggtgcctctggctttccaggtgccaaaggtgaaatgggtatg
atgggacctccaggcccaacaggacctttgggaattcctggcaggagtggtgttcctggt
ctcaaaggtgatgatggtttgcagggtcagccaggacttcctggccctacaggagagaaa
ggtagtaaaggagagcctggccttccaggccttcctggaccaatggatccagatctgctg
ggctcaaaaggagagaaaggagaccctggcctaccaggtattcctggagttgcagggcca
aaaggttatcagggtttgcctggagacccagggcaacctggactgagtggacagcctgga
ttaccaggaccatcgggtcccaagggtaaccctggtctccctgggaagccaggacttaca
ggacctcctggacttaaaggaaacataggcgatatgggttttccaggcccccagggtgca
aaagggtctcctggacctcctggagttcctggacaatctggatccccgggattacctgga
cagaaaggagaaaaaggtgatcctggtatttcaggcattggtcttccaggtcttcctggc
ccaaagggtgaacctggtctgccgggatacccagggaaccctggtatcaaaggtgctatg
ggagacactggtttgcctggattaccggggacccctggagcaaaaggacaaccaggcctt
cctggattccctggaaccccaggccttcctggaccaaaaggtattaatggtcctcctggg
aaccctggccttccaggagaacctggtcctgtaggtggtggaggtcgtcctgggccacca
gggcctccaggtgaaaaaggcaaaccaggtcaagatggtattcctggaccagctggacag
aagggtgaaccaggtcaaccaggctttggaatcccaggaccccctggacttccaggactt
tctggtcaaaagggtgatggaggattacctggcattccaggaaaccctggccttccaggt
ccaaagggtgaaccaggctttcatggtttccctggtctgcagggtcccccaggccctcct
ggttctccaggtccagctctggaaggccctaaaggcaaccctgggccccaaggtcctcca
gggagaccaggtctaccaggtccagaaggtccccggggtctccctggaattgggggcatt
aaaggagagagaggaaacccgggccaacctgggcaacctggtttgtctggtttgaaagga
gatcaaggaccaccaggactccagggtaatcctggccggccaggtctcaatggaatgaaa
ggagatcctggtctccctggtgttccaggatttccaggcatgaaaggacccagtggagaa
cctggttcaactggccctgagggggatccaggacttattggccccccaggcccccctgga
ttacctggtccttcaggacagagtattgtaatcaaaggagatgctggtccaccaggggtt
ccaggccagcctggattaaaaggtctaccaggactaccaggacctcaaggtttaccaggt
ccaattggccctccaggagatcctggacgcaatggactccctggctttgatggtgcagga
gggcacaaaggagacccaggtttaccaggccagccaggtatccgtggtttggatggtccc
cccgggccagatggattgcaaggtcccccaggtccccctggaacctcctctgttgcccat
ggatttctcatcacacgtcacagccagacaacagatgcaccacaatgcccacagggaact
atccaggtttatgaaggcttttctctcctgtatgtacaaggaaataaaagagctcacggt
caagacttgggaacggccggcagctgccttcgtcgcttcagtaccatgcctttcatgttc
tgcaacatcaataatgtttgcaactttgcttcaagaaatgactattcttactggctctcc
accccagagcccatgccaatgagcatggagcccctgaagggccagagcatccagccattc
attagtcgatgtgcagtatgtgaagctccggccgtggtgattgcagttcacagtcagacc
atccagattccccgttgtcctcagggatgggattctctctggattggttattccttcatg
atgcacacaagtgcaggggcagagggctcaggtcaagccctggcctcccctggttcctgc
ttggaagagtttcgttcagctcccttcattgagtgtcatgggcgggggacctgcaactat
tacgccaactcctacagcttttggctggcaactgtagatgtgtcggacatgttcagcaaa
cctcagtcagaaacgctgaaagcaggagacttgaggacacgtattagtcgatgtcaagtg
tgcatgaagaggacataa

KEGG   Delphinapterus leucas (beluga whale): 111165781
Entry
111165781         CDS       T05885                                 

Gene name
COL4A6
Definition
(RefSeq) collagen alpha-6(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04974  Protein digestion and absorption
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111165781 (COL4A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111165781 (COL4A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111165781 (COL4A6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111165781 (COL4A6)
  09154 Digestive system
   04974 Protein digestion and absorption
    111165781 (COL4A6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165781 (COL4A6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111165781 (COL4A6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111165781 (COL4A6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111165781 (COL4A6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111165781 (COL4A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111165781 (COL4A6)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111165781 (COL4A6)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111165781 (COL4A6)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111165781 (COL4A6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 111165781
NCBI-ProteinID: XP_022412452
UniProt: A0A2Y9LZJ9
LinkDB
Position
Unknown
AA seq 1706 aa
MHPGLWLLLVTLCLTEELAGAGEKKPYGKPCGGQDCIGGCKCSPEKGARGRPGPIGIQGP
VGPQGFPGPSGLSGLKGEGGSPGPLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGEPILAQGSFKGMKGEPGLPGLD
GITGPQGAPGSPGAVGPIGPPGLQGPPGPPGFPGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGLQGFPGISGPPGLPGFGIAGEKGEKGIPGLPGPRG
PTGLEGVQGPPGSQGKKGSSGFPGLNGFPGIKGEKGDIGQPGPDVFIDTDGAVISGYPGD
PGMPGLPGLKGDEGIQGLPGPPGAPGLPALPGGPGTLGLQGVPGLKGDQGNPGHTTIGAA
GLPGRDGLPGLPGLPGLPGPAFETGTLQSTEPGLPGLRGERGPKGNPGLKGIKGDSGFCA
CDGGVPNIGPPGEPGLPGPPGLLGLPGLKGARGDPGFGGAQGPSGDPGVFGPRGLEGPKG
KKGEATLSTGSGMPGDQGDPGLQGLPGETGAPGKDGVPGLPGLPGFQGDGGQGFPGEKGL
PGLPGEKGRTGPIGPPGIGLPGSSGPRGLPGDKGVDGFPGQPGPPGIPGDCCCREKVGQG
DLDTEGGITLPCIIPGPYGPSGFPGAPGFPGPNGARGLPGTPGQPGLHGNKGEPGSPGLV
HLPEMPGFPGPRGEKGLPGFPGLPGKDGLPGKVGSPGLPGPKGAPGDIIGAENGAPGKQG
LQGLPGDRGFPGDSGLTGPKGLLGKSGLLGPKGDRGSPGIPGRAGQPGPRGSDGLFGIKG
KPGLPGAPGFPGTSGHPGKKGPRGDIGPPASAGKRGLPGLKGLPGSPGLIGFLGNSGLPG
ATGLPGLPGPKGEKGSVGLIGFPGIPGLPGIPGASGLKGIPGSMGRVGPSGQAGSPGEKG
DRGDPGPVGVPSPRLPVLNLHFTGDKGSQGSPGSIGFPGPRGDKGEAGSPGPPGLPGAPG
FPSLIKGLSGRPGSPGSTGLRGLPGLKGSPGITGFPGIPGESGSQGLSGAPGLPGASGLP
GLKGDQGQTLGISGSPGPKGQPGEPGFKGVKGKDGPVGDVGFPGNKGEDGKVGISGDVGL
PASPGLPGVAGMRGNPGLPGSSGHPGAAGPLGPPGLIGTKGFPGLSGLHGLNGLPGTKGT
HGTPGPSITGVPGPAGLPGPKGEKGSLGIGIGVPGKPGVRGPKGSRGFPGLQGPAGLPGA
PGLSLPSVIAGQPGDPGRPGLDGEQGRPGPPGLPGPPGPSSDQGDPGDPGFPGIPGPQGP
KGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGLPGMKGKAGPRGLSGPRGA
PGQTPIAEAIEAPPGPMGLTGIDGIPGLMGDPGAQGPGGLQGFKGLPGIPGKDGPNGLPG
PPGALGDPGLPGLQGPPGFEGAPGKPGPFGRAGMPGQSVRVGYTLVKHSQSEQVPLCPVG
MSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWL
STTAPIPMMPVGQTQIPPYIGRCSVCEAPSQAIAVHSQDITIPQCPTGWRSLWIGYSFLM
HTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEEREQFGE
EPVSETLKAGQLHTRVSRCQVCMKSV
NT seq 5121 nt   +upstreamnt  +downstreamnt
atgcaccctgggttgtggcttctcctggttacgttgtgcctgaccgaggaactggcagga
gcgggagagaagaagccctatggaaagccatgtggaggccaagactgcattgggggctgt
aaatgctctcctgagaaaggagcccgagggcgaccaggaccaattggaattcaaggtcca
gtgggtcctcaaggatttcctggccctagtggtttatcagggttgaaaggagaagggggc
tccccaggacctctgggaccgtatggaccaaaaggagataagggtcccatgggagttcct
ggctttcttggcatcaatgggattccgggccaccctggacagccaggacccagaggccca
cctggcctggatggctgtaatggaactcaaggagctgttggatttccaggccctgatggc
tatcccgggcttctcggaccacccgggcttcctggtcagaaaggctctaaaggtgaacct
atccttgcccaaggtagtttcaaaggaatgaagggggagcctgggctgcccggactggat
ggaatcactggcccacaaggagcacccggatctccaggagctgtgggacccataggacca
ccaggattgcaaggtcctccaggcccccctggtttccctggtcctgatgggaatatgggg
ttaggtttccaaggagagaaaggagtcaagggggatgttggcctgcctggccctgcagga
cccccaccatctactggggaactggaattcatgggatttcccaaagggaagaaaggatcc
aagggtgaaccagggcttcagggcttcccaggaataagtggtcctccaggtctcccgggt
tttggaattgctggagaaaaaggagaaaagggaatccctggtttgccgggacctaggggt
cccacgggtttagaaggagtccaaggccctccggggagtcagggcaagaaggggtcttca
ggtttccccgggcttaatggattcccaggaattaagggtgaaaagggtgacattggccag
ccaggcccagatgttttcatcgatacagatggtgctgtgatctcaggttatcctggagac
cccggtatgccaggcctcccaggccttaaaggagatgaaggcatccagggcctgcctggc
cctcctggtgcccctggattaccagctttaccaggtggccccggtactctagggctccag
ggagttccaggcctgaagggggaccaaggaaaccccggccacaccacaattggggcagct
ggcctccctggcagagatggtttgccaggcctaccaggcctaccaggcctacccggtcca
gcatttgagacgggaactctacagagcacagagccagggttgcctggtctccgaggagaa
cgaggtccaaaaggaaacccaggcctcaaaggaatcaaaggggactctggtttttgtgct
tgtgatggtggtgtcccaaacattggaccacctggggagccaggcctacctgggccacca
ggtctcctgggccttccgggcctgaaaggagcgagaggagatccaggctttggaggtgca
cagggcccatcaggggatccaggtgtatttgggcctcgaggtctggaaggccccaaagga
aagaaaggggaagcgactctcagtacaggatcagggatgccaggagatcagggtgatcct
ggtctccaggggctccctggtgagacaggagccccaggcaaggacggagtaccaggttta
ccaggcctgccaggctttcagggtgatggtggacagggcttcccaggtgaaaaggggtta
ccaggacttcctggtgaaaaaggccgcactggtccaattggccccccaggaattgggcta
ccaggatcttctggacctcgtgggcttcctggagataaaggagtagatggattcccaggg
caaccaggcccccctgggattccaggtgactgctgctgcagggagaaggttgggcaagga
gacttagacacagagggaggtatcaccttgccttgtattattcctgggccatacggtcca
tcaggattcccaggagctcccggattcccaggccctaatggggcccgtggcctccctggg
actccaggccagcctggattgcatggaaataaaggggagcccggaagtccaggattggtt
cacctccctgaaatgccaggatttcctggacctcgtggagagaagggcttgcctgggttt
cctgggctccctggaaaagatggcttgcctgggaaagttggcagtcccggcttaccaggt
cccaagggagcccctggtgacatcattggtgctgaaaatggtgctcctgggaagcaaggc
ctacagggactgccaggagacagaggatttcctggagactctggccttacaggacccaag
ggtttgcttgggaagtcgggcttgctgggccccaaaggtgatcggggcagccctggaata
ccaggccgcgcaggacagccaggcccccggggatctgatggtctatttggcatcaagggc
aaacccgggctcccaggagcaccaggctttccaggcacttcaggacatcctggaaagaaa
ggtccaagaggcgatataggtccccctgcatcagctggaaagagaggcctgcctgggctg
aaaggccttccgggatctccagggctaattggcttcctggggaactccggcttgccaggg
gccactggactgccaggcctgccaggtccgaagggtgagaaggggtctgttggactgata
ggttttccagggattccaggtctccctggtattcctggtgcaagtggattaaagggaatt
cctgggtcgatgggaagagttggaccatctggacaggctggtagccctggtgaaaaagga
gacagaggcgacccggggccagtcggagtacccagccccagacttccagtgctgaacctg
cacttcacaggagataaaggctctcagggctcacctggatccatcggatttcctgggccc
agaggtgacaaaggagaggctggcagccctgggccaccaggcttgcctggagctcctggc
ttccccagcctcatcaagggacttagtgggagaccaggctcccctggctccacaggacta
cggggcttacccggcctgaaggggtcccctggaatcacaggtttcccaggaataccagga
gaaagtggttcacagggtctcagtggagctcctgggctcccaggagcatctggtctccca
ggtttaaaaggagatcaaggccagacacttggaatttctggtagcccaggacccaaggga
caacctggggagcctggtttcaaaggtgtgaaaggaaaagatggaccagttggtgatgtg
ggtttcccaggaaacaaaggtgaagatgggaaagttggtatttctggagatgttggcctt
cctgcctccccaggactccctggggttgcaggcatgagaggaaatccagggcttccaggt
tcttcaggccacccaggggcagctgggcccctgggaccccctggcctaataggaaccaaa
ggtttccctggactttctggtttacatggactgaatgggctgccaggaaccaagggaacc
catggaactccaggacctagtataaccggtgtgcctgggccagctggcctgcctggtccc
aaaggagaaaaaggttctctaggaattggcatcggagtcccaggaaagccaggcgtgaga
ggaccaaaaggtagcaggggtttcccaggtctccagggccccgctggtctccctggtgcc
ccaggtctctccttgccctcagtcatagcaggacaacctggcgaccccgggcgaccaggc
ctagatggagaacaaggccgcccaggccccccggggctcccaggaccccctgggccatcc
tcggatcaaggcgacccgggagaccctggcttccctggaattcctggccctcaagggccc
aagggagaccaaggaattccaggtttctctggcctccctggagagctaggactgaaaggc
atgagaggtgagcctggcttcatggggactccaggcaaagtcgggccacctggagaccca
ggacttccggggatgaaggggaaggcagggccaagaggcttatccggcccccgaggcgct
cctggacaaacaccaattgcagaagccatcgaggctcctcctggacccatgggtctaaca
ggcatcgatggcatccctggcctcatgggggaccctggggcccaaggccctggaggccta
caaggcttcaaaggtttacctggcatccccggcaaagacggccccaatggactccctggc
ccacctggggctcttggtgatcctggtctccctggactgcaaggccctccaggatttgaa
ggagctccagggaagccggggcccttcgggagggctggaatgcctgggcagagcgtgaga
gtgggctacaccttggtgaagcacagccagtcagaacaggtgcccctgtgccccgtcggg
atgagccagctgtgggtcggttatagcctgctgttcgtggaggggcaggagaaagcccac
aaccaggacctggggtttgctggctcctgcctgccccgcttcagcaccatgcccttcatc
tactgcaacatcaacgaagtgtgccactatgcccggcgcaacgataaatcctactggctc
tccaccaccgcgcccatccccatgatgcccgtcggccagacgcagattcccccgtacatc
ggccgctgctctgtgtgtgaggcgccctcacaagccattgctgtgcacagccaggacatc
accatcccgcagtgccccacgggctggcgcagcctctggattgggtactccttcctcatg
cacacggccgccggcgctgagggcgggggccagtccctggtctcccctggctcctgccta
gaggatttccgagccactcctttcatcgagtgcagtggtgcccggggcacctgccactac
tttgccaacaagtacagtttctggctgacgacggtggaagagagggagcagtttggggag
gagcctgtatctgagacgctgaaagccgggcagctccacacccgggtcagccgctgccag
gtgtgtatgaaaagcgtgtag

KEGG   Delphinapterus leucas (beluga whale): 111168261
Entry
111168261         CDS       T05885                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111168261 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111168261 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168261 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168261 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111168261 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111168261 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111168261 (LAMA2)
   05414 Dilated cardiomyopathy
    111168261 (LAMA2)
   05416 Viral myocarditis
    111168261 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111168261 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111168261 (LAMA2)
   05145 Toxoplasmosis
    111168261 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 Laminin_EGF Laminin_I Laminin_B Laminin_II Laminin_N Laminin_G_3 DUF948
Other DBs
NCBI-GeneID: 111168261
NCBI-ProteinID: XP_022417592
UniProt: A0A2Y9MEX4
LinkDB
Position
Unknown
AA seq 3008 aa
MRTLWNSELHVVAVTLPQVFQIAYVIVKAANSPRPGNWILERSLDDVDYKPWQYHAVTDT
ECLTLYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDLSPELLE
FTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHAR
ACPLDPVTNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECY
YDENVARRNLSLNIHGKYIGGGVCINCTGNTAGINCETCIDGFFRPKGISPNYPRPCQPC
HCDPIGSLSEVCVKDEKRAQRGLAPGSCHCKPGFRGVSCDRCARGYTGYPDCKPCNCSGA
GSTNEDPCFGPCNCKENVEGGDCSRCKFGFFNLQEDNHRGCDECFCSGVSDRCQSSYWTY
GNIQDMSGWYLTDISGHIRVTPQQDDLDPHQQISISVVKARQALPQSYYWSAPALYLGNK
LTAVGGQLTFTVSYDLEEEEEDTEHILQLMIILEGNDLRISTAQDEVYLQPSEEHINVLS
LKEDLFTIHGTNFPVSRKEFMTVLANLKRVLIQITYSLGMDAIFRLSSVGLESAVPYPTD
RSIAAAVEVCQCPSGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDITGECL
NCKDHTGGLYCNKCLPGFYGDPTKGTSDDCQPCACPLNIPSNNFSPTCHLDRNLGLICDE
CPVGYTGPHCERCAEGYFGQPSLPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTT
GRYCELCADGYFGDAVDAKNCQPCLCNANGSFSEVCHAQTGQCECKPNVQGRQCDECKPE
TFGLQSARGCIPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTAC
DCSHLGNNCDPKTGRCICPPNTIGEKCSKCIPNTWGHSITTGCKPCNCSSVGSLDFQCNI
NTGQCNCRPKFSGAKCTECNRGHWSYPHCNPCDCFLPGTDDSTCDLETKKCSCTDKTGQC
TCKVNVEGVRCDRCRLGKFGLEAKNPLGCSSCYCFGATTQCSEAKGLIHTWVTLKPEQTI
LPLVDEALQHTTIRGIIFQHPEIVAHMDLVRQDLHLEPFYWKLPEQFEGKKLMAYGGKLK
YTIYFEAREETGFSTYNPQVIIRGGTPSHVRIIIRHMAAPLIGQLTRHEIEMTEKKWKYY
GDDPRISRTVTREDFLDVLYDIHYILIKATYGNIMRQSRISEISMEVAEQGRITAMTPPA
HLIERCDCPPGYSGLSCEACMPGFYRLRSEPGGRTPGPALGTCVPCQCHGHSSLCDPETS
ICQNCQHHTAGDFCERCVLGYYGTVKGLPDDCQQCACPLISSSNNFSPSCVTEGLDDYRC
TACPREYEGQYCERCAPGYTGSPSSPGGSCQECECDPHGSLPVPCDPVTGICTCRPGATG
QKCDGCKHWHAREGMECVFCGDECTGLLLGDLARLEQMATSINLTGPLPAPYKILYGLEN
MTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTR
ASSLGEFIKDLAQHAEAVSEKAVKLNETLGIQDKAFERNLQELQNEVDKMMTELRRKNLD
TQKEVAEDELVAAEALLKKVKKLFGESRGKNEEMEKDLREKLADYKSKVDDAWDLLREAT
DKIKEANLLSAENQKNMTALEKKKEAIESGKRQTEDTLKEGTDILDEANRLADEINSVID
YVEDIQTKLPPLSEDLKDKIEDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDRILDEA
KNISFNATAAFKAYSNIKDYIDKAEKIAKEAKVLAHEATELATGPQGSLQEGAKGSLQKS
FGFLNEAKKLANDVKENDEHLNGLTTRLDNANVRNRGLLRALNDTLEKLSAIPNDTAAKL
QAVKDKARQANDTAKDVLAQIKDLHQNLDGLKKNYNQLADSVAKTNAMVKDPSKNKIIAD
ADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDC
IRTYKPEIKKGSYNNIIVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGV
GRVEYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIMPSTYHSASPPGYTILDVD
ANAMLFVGGLTGKLKKADAVRVVTFTGCMGEAYFDSKPIGLWNFREIEGDCKGCTVSPQV
EDSEGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSNALLMYLATRDLKDFMSVELT
DGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRTQKQANISIVDIDTNQEENIATSSP
GNNFGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLRDIEISRTPYNILSSPDY
VGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPP
RRKRRQTGQAYYAIFLNKGRLEVHLSTGARTMRKIAVKPEPSLFHDGREHSVHVERTRGI
FTVQVDEDRRHVQNLTVEQAIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPM
DFAQPVSFKNADIGRCAHQKPPEDEDGAVPAETVIQPEPVPTPAVPAPTPVLAHAPCAAE
SEPALLIGSKQFGLSRNSHIAIAFDDTKVKNRLTIEFEVRTQAESGLLFYMARINHADFA
TVQLRNGLPYFSYDLGSGDSNTMIPTKINDGHWHKIKIIRIKQEGIIYVDGASNRTISPK
KADILDVVGMLYIGGLPINYTTRRIGPVTYSIDGCIRNLQMAEAPADLEQPTSSYRVGTC
FANAQKGTYFDGTGFAKAVDGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIA
EKLMFHVDNGAGRFTAVYDAGIPGHLCDGQWHKVTANKVRHRIELTVDGNQVEAQSPNRA
STSADTNDPVFVGGFPEGLNQFGLTTNIRFRGCIRSLRLTKGTGKPLEVNFVKALELRGV
QPVSCPAN
NT seq 9027 nt   +upstreamnt  +downstreamnt
atgagaacactttggaattcagagttacatgttgttgctgtcactcttccccaggtgttc
cagattgcgtatgtgattgtgaaagcagctaattcccctcggcctggaaactggattttg
gaacgctcacttgatgatgttgattataagccctggcagtatcatgctgtgacggacaca
gagtgcctaacactctacaatatttatccccgcactggaccaccatcatacgccaaagac
gatgaggtcatctgcacttcattttattccaagatacaccccttagaaaacggagagatt
cacatctctttgatcaatgggagaccaagtgctgatgatctgtctcctgaactgctagaa
tttacctccgcccgctatattcgcctgagatttcagaggatccgcaccttgaatgccgat
ttgatgatgtttgctcacaaagacccaagagaaattgaccccattgtcacacgaagatat
tactactcggtcaaggatatttcggttggagggatgtgcatctgctatggtcatgccagg
gcttgtccacttgatccagtgacaaataaatcccgctgtgaatgtgagcataacacgtgt
ggtgatagctgtgatcagtgctgtcctggatttcatcagaaaccgtggagagcaggcact
tttctgaccaaaactgaatgtgaagcctgcaattgtcatgggaaagctgaagaatgctat
tatgatgaaaatgttgccagaagaaatctgagtttaaatatacatggaaagtacattgga
gggggtgtgtgcattaattgtactggaaacaccgctggtataaattgtgagacatgcatt
gatggtttcttcagacccaaagggatatctccaaattatccaagaccatgccagccatgc
cattgtgacccaattggttccttaagtgaagtctgtgtcaaggatgaaaaacgtgctcaa
cgaggtctggcacctgggtcctgtcattgcaaacctggcttcagaggggtgagctgtgat
cggtgtgccaggggctacactggctacccagactgcaaaccctgtaattgcagtggtgca
gggagcacaaatgaggacccttgttttggaccctgtaactgcaaggaaaatgtcgaagga
ggagactgtagtcgctgcaaattcggcttcttcaatttgcaagaggataatcatagaggt
tgtgatgagtgtttctgttcaggggtttcagacagatgtcagagctcctactggacctat
ggcaatatacaagacatgagtggctggtatctgactgacatctctggccacattcgagtg
actccgcagcaggatgacttagatccacatcagcagatcagcatcagcgtcgtgaaggcc
cgacaagccctgccccagagctactactggagcgcgccagctctgtatctgggaaacaaa
ctcacagcagttggaggacaattgacatttactgtatcatacgaccttgaagaagaggag
gaagatacagaacacatactccagcttatgatcatcttagagggaaatgacttgagaatc
agcactgcccaagatgaggtgtatctgcaaccatctgaagaacatattaatgtgttgtca
cttaaagaagatttatttaccatacatggcacaaatttcccagtcagtaggaaagagttt
atgaccgtgcttgcgaatttaaagagagtccttatacaaatcacatacagccttgggatg
gatgccatcttcaggctgagctctgttggccttgaatctgctgtcccctatcctactgac
agaagcattgcagcagctgtggaagtttgtcaatgtccatcagggtatactggctcctcc
tgtgaatcttgttggcctaggcacagacgagttaacggcactatttttggtggcatctgt
gaaccctgtcagtgctttggtcacgcggaatcctgtgatgatatcactggagaatgcctg
aactgtaaggatcacactggtggcctatattgcaataaatgtcttcctggtttctatggt
gatcctactaaaggaacctctgatgactgtcagccctgtgcctgtccactcaatatccca
tccaataactttagcccgacgtgccatttggaccgaaatcttggcttgatctgtgatgaa
tgccctgtcgggtacacaggaccacactgtgagaggtgtgcagaaggctattttggacaa
ccttctctacctggaggatcgtgtcagccatgccagtgcaatgacaaccttgacttctcc
atccctggcagctgtgacagcttgtctggctcctgtctgatatgtaagccaggtacaaca
ggccggtactgtgagctttgtgctgatggatattttggagacgcagttgatgcaaagaac
tgtcagccttgcctctgtaatgccaacggctccttttctgaggtttgccacgctcagacg
ggacagtgtgaatgcaaacctaacgtgcaggggcggcagtgtgatgaatgtaagcctgaa
acctttggcctccaatcagcaagggggtgtattccctgcaactgcaattcctttgggtct
aaatcatttgactgcgaagagagtggtcagtgttggtgccagcccggagtaacaggaaag
aaatgtgatcgctgtgcccacggctatttcaactttcaagaaggaggatgcacagcttgt
gactgttcccatctgggtaataattgtgacccaaagacaggtcgatgcatttgcccaccc
aataccattggagagaaatgttctaaatgtatacctaatacctggggccacagcattacc
actggttgtaagccttgtaactgcagctcggtgggatccttggatttccaatgcaatata
aacacggggcaatgcaactgtcgtcccaaattctctggtgcaaaatgtacagagtgcaat
cgaggccactggagctaccctcactgcaatccctgtgactgcttcctgccagggactgat
gactcaacctgtgatttagagactaaaaaatgctcctgtactgataagactgggcagtgt
acttgtaaggtgaatgtggaaggcgtccgctgtgacaggtgccggcttggcaaattcgga
cttgaggccaagaacccacttggctgcagcagctgctattgcttcggcgccactactcag
tgctctgaagcaaaaggactgatccatacgtgggtgactctgaagcctgagcagaccatt
ctgcccctggtggatgaggcactgcagcacacaactatcagaggcatcatttttcaacat
ccagagattgttgcacacatggatctggtgagacaagatctccatttggaacctttttat
tggaaacttccagaacaatttgaaggaaagaagttgatggcctatgggggcaaactcaag
tacacaatctattttgaggctcgggaagagacaggtttctctacatataacccacaagtt
atcattcgaggggggactcctagtcatgtgagaattatcatcaggcatatggctgctcct
ctaattggccagttgacaagacatgaaattgaaatgacagagaaaaaatggaaatattat
ggtgatgatcctcgaatcagtagaaccgtgacccgtgaagacttcttggatgtactatat
gatatccattatattcttatcaaggctacctatggaaatatcatgagacaaagcaggatt
tctgaaatctcaatggaggtagctgaacaaggacgcatcacagcaatgactcctccagct
cacttgatagaaagatgtgattgtcccccgggctattctggcttgtcctgtgaggcatgc
atgccaggattttatcgactgcgttctgagccaggtggccgtacccctggaccagccctg
ggcacctgtgttccatgtcagtgtcatggacacagcagcctgtgtgaccctgaaacctcc
atatgccagaattgtcaacatcacactgctggtgacttctgtgaacgatgtgttcttgga
tattatggcactgtcaagggattgccagatgactgtcagcaatgtgcttgccctctgatt
tcttccagcaacaatttcagcccttcttgtgtcacggaaggcctggatgattaccgctgc
acagcttgccctcgagaatacgaaggccagtactgcgaacggtgtgcccctggctatacc
ggcagcccaagcagccccggaggctcctgccaagaatgtgagtgtgacccccatggctca
ctgcccgtcccctgtgaccctgtcacagggatctgcacgtgccgacccggagccacgggg
cagaagtgtgacggctgcaaacactggcatgcgcgcgagggcatggagtgtgttttttgt
ggagatgaatgcaccggccttcttctcggtgacttggctcgcctggaacagatggccacg
agcatcaacctcactggcccactgcccgctccttataaaattctgtatggtcttgaaaat
atgactcaggaactcaagcatttgctctcacctcagcgggccccagagaggctcattcag
ttggcagaaggcaatctgaacacgctggtgacagaaatgaatgaacttctgaccagggct
accaaagtgacagcagatggagagcaaactggacaggatgcagagaggaccaacacgaga
gcaagctccttaggagaattcattaaggacctggcccagcacgcagaagctgtaagtgaa
aaagctgtaaaactaaatgaaactctaggaattcaagacaaggcctttgagagaaatttg
caagagcttcagaatgaagttgataagatgatgacagaactgaggaggaaaaatctagac
acacaaaaggaagttgctgaagatgagttggtagctgcagaagcccttctgaagaaagtg
aagaagctgtttggagaatcccgagggaaaaatgaagaaatggagaaggatctccgggag
aaactggcagactacaaaagcaaggttgatgatgcttgggacctgttgagagaagccaca
gataaaatcaaagaagctaatctcttatctgcagaaaaccagaaaaacatgactgctttg
gagaaaaagaaggaggctattgaaagtggcaaacgacaaactgaggacactttaaaagaa
ggcactgacatacttgatgaagccaaccgtcttgcagatgaaatcaactcagtcatagac
tatgttgaagacattcaaactaaattgccacccctgtctgaggatctgaaagataaaata
gaagacctctcccaagaaataaaggacaggaagcttgctgagaaggtgtcccaggctgag
agccatgcggctcagttaaatgattcatctgctgtccttgatagaatccttgatgaggcc
aaaaacatctccttcaatgccactgcagccttcaaagcttacagcaatattaaggactat
attgataaagctgagaaaattgccaaagaagccaaagttcttgcacatgaagccacagaa
ctggcaacaggtcctcagggttcattacaggaaggtgccaaaggctctcttcagaaaagc
ttcgggtttcttaatgaagccaagaagttagcaaatgatgtaaaagaaaatgatgaacat
ctgaatggcttgacaaccagattagacaatgccaatgtcagaaacaggggtctcctgaga
gctctgaatgacactttggaaaagttatcagccattccaaatgacacagccgctaaactg
caagcggttaaggacaaagcaagacaagccaacgacacagctaaagatgtactggcacag
attaaagatctccaccagaatcttgatggcctgaagaaaaattacaatcaactggcagac
agcgtagccaaaacaaatgccatggtaaaagatccttcaaagaacaaaatcattgcagat
gcagatgccactgtaaaaaatctagaacaagaagctgatcgactgatagataaactcaaa
cccatcaaggaacttgaggataacctgaagaaaaacatctctgagataaaagaactgata
aaccaagcccggaagcaggccaattctatcaaagtatctgtgtcttcgggaggtgactgc
attcgaacatacaaaccagaaatcaagaaaggaagctacaataatatcattgtcaacgta
aagacagctgtcgcggacaacctccttttttatcttggaagtgccaaatttattgacttt
ctggctatagaaatgcgtaaaggcaaagtaagcttcctctgggatgttggatccggagtt
ggacgtgtcgagtatccagatttgactattgatgactcatattggtaccgtattgaggca
tcaagaactgggagaaacggaacaatttccgtgagagctctggatggacccaaagccagc
attatgcccagtacataccattcagcgtcacctccagggtacactattctagatgtggac
gcaaacgcaatgctgtttgttggtggcttgactgggaaattgaagaaggctgatgctgta
cgtgtggttacattcactggctgtatgggagaagcatactttgacagcaaacctataggg
ttgtggaatttccgagaaatagaaggtgactgcaaaggatgtaccgtcagtccgcaggta
gaagatagtgaggggactattcagtttgatggagaaggctatgcattagtcagccgcccc
attcgttggtaccccaacatctctactgtcatgttcaagttcaggacattttcttcaaat
gctctcctgatgtaccttgccacacgagacctgaaagatttcatgagtgtagagctcact
gatggacacataaaagtcagctatgatctgggttcaggaatggcttccgttgtcagcaat
caaaaccataatgatgggaaatggaaatcattcaccttgtcaagaactcaaaaacaagcc
aacatatcaattgtggatatagatactaaccaggaggagaacatagcaacttcatctcct
ggaaacaacttcggtcttgacttgaaagcagatgacaaaatatattttggtggtctgcca
acactgagaaatttgagtatgaaagcaaggccggaagtaaatttgaagaaatattctggc
tgcctcagagatattgaaatttcaagaactccatataatatacttagcagccctgattat
gttggtgttaccaaaggatgttcactggagaacgtttacacagttagcttcccgaagcct
ggttttgtagagctgtcccctgtgcctattgatgtaggaacagaaatcaacctgtccttc
agcaccaagaatgagtctggtattattctcttgggaagtggagggacaccagcgccacct
aggagaaaacgaaggcaaactggacaggcctattatgcgatattcctgaacaagggtcgt
ctggaagtgcatctctccacaggggcacgaacaatgaggaaaattgccgtcaaaccagag
ccgagtctgtttcacgacgggagagaacattctgttcatgtggagagaactagaggcatc
tttactgttcaagttgatgaagacagaaggcatgtgcaaaatctgacagtagaacaggcg
atagaagttaaaaagcttttcgtcgggggtgctccacctgaatttcaaccttccccactc
agaaatattcctccttttgaaggctgtatatggaacctcgttataaactctgtccctatg
gactttgcacagcctgtatccttcaaaaatgcagacatcggtcgctgtgcccatcagaaa
ccacctgaggatgaagatggagcagttccagctgaaacagttatccagccagagccagtt
cccaccccagccgtacctgcacccaccccagttctggcacatgctccttgtgctgcagaa
tcggaaccagctctcctgatagggagcaaacagtttgggctttcgagaaacagtcacatt
gcaattgcatttgatgacaccaaagttaaaaaccgtctcaccattgaatttgaagtgcga
acccaagctgaatcaggcttgctcttttacatggcccggatcaatcatgctgattttgct
acagttcagctgagaaatggattgccctacttcagttatgacttgggaagtggtgacagc
aacaccatgatccccaccaaaatcaatgatggccattggcacaagattaagattattcga
attaagcaagaaggaattatttacgtagacggtgcctccaacagaaccatcagtcccaag
aaagctgatattctggatgttgtgggaatgctgtatattggcgggctacccattaactac
actacccgaagaattggtccagtgacctacagcattgatggctgcatcaggaatcttcag
atggcagaagcccctgctgatcttgaacagccaacctccagctaccgtgtcgggacgtgt
tttgcaaatgctcagaaaggaacgtattttgacggaacgggttttgccaaagcagttgat
gggttcaaagtaggattggaccttcttgtagaatttgaattccgcacaactagaaccact
ggagttcttctgggaatcagcagccagaaaatggatggaatgggtattgaaatgattgct
gaaaagcttatgtttcatgtggacaatggcgccggccgattcactgctgtctatgatgct
gggatcccagggcatttgtgtgacggacagtggcataaagtcacggccaacaaggtcagg
caccgaatcgagctgacagtagatgggaaccaggtggaagcccagagcccaaatcgagca
tctacatccgctgatacaaatgaccccgtgtttgttggagggttcccagagggcctcaac
cagtttggcctgacaaccaacattcgtttccgaggttgcatccgatccctaaggctcacc
aaaggcacgggaaagccattggaggtgaattttgtcaaggccctggaactaaggggtgtt
caacctgtatcatgcccagccaactaa

KEGG   Delphinapterus leucas (beluga whale): 111171803
Entry
111171803         CDS       T05885                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04810  Regulation of actin cytoskeleton
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05100  Bacterial invasion of epithelial cells
dle05135  Yersinia infection
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111171803 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111171803 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111171803 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111171803 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171803 (FN1)
   05205 Proteoglycans in cancer
    111171803 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111171803 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111171803 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111171803 (FN1)
   05100 Bacterial invasion of epithelial cells
    111171803 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111171803 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111171803 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111171803 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111171803 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111171803 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111171803 (FN1)
Membrane trafficking [BR:dle04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    111171803 (FN1)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   111171803 (FN1)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111171803 (FN1)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   111171803 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 111171803
NCBI-ProteinID: XP_022423328
UniProt: A0A2Y9N239
LinkDB
Position
Unknown
AA seq 2387 aa
MLGDPGPRLLLLLTVLSLGTAVPSTGASKSKRQAQQVIQPQSPLAVSQSKPGCYDNGKHY
QINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWRKKDNRGNLLQCICTGNGRGEWKCERHTTLQTTSAGSGSFTDVRTAIYQPQPH
PQPAPYGHCVTDSGVVYSVGMQWLKAQGNKQMLCTCLGNGVSCQETAITQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNQNYTDCTSEGRRDNMKWCGTTRNYDADQKFGFCPMAAHEEICTTNEGIMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPIDQCQDSESRTFYQIGESWEKFLHGVRYQCYCYGRGIGEWGC
QPIQTYPGSTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPDRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGQREMTRFDFTTTSTSPVVTSNTVTGETTPFS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKITIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRN
TFAEVTGLSPGVTYHFKVFAVNHGRESKPLTAQQATKLDAPTNLQFINETDTTIIVTWTP
PRARIAGYRLTVGLTRGGQPKQYNVGPSSTQYPLRNLQPGSEYSATLVAVKGSQQSPRAT
GVFTTLQPLSSIPPYHTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIV
VSGLTPGVEYIYTISVLKDGQERDTPIVKKVVTPLSPPKNLHLETNPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPI
SDTIMPAVPPPTDLRFTNVGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSVSPS
DNAVFLTNLLPGTEYLVSVSSVYEQHESVPLRGRQKTGLDSPTGIDFSDITANSFTVHWI
APRATITGYKIRHHPEHMGGRPREDRVPPSRNSITLTNLNPGTDYVVTIVALNGKEESPS
LVGQQTTVSDVPRDLEVIAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGS
KSTATISGLKPGADYTITVYAVTGRGDSPASSKPISIDYRTEIDKPSQMQVTDVQDNSIS
VRWLPSSSPVTGYRVTTTPKNGPGPSKTMTAGPDQTEMTIEGLQPTVEYVVSVYAQNRNG
ESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPA
PDGEEETAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTNLKFTQVSPTSLA
AQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTL
TSRPAQGVVTTLENVSPPRRARVTDATETAITISWRTKTETITGFQVDAIPANGQTPIQR
TIKPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDASTAIDAPSNLHFLATTPNSL
LLSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGIEYTIQVIALKNN
QKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPGT
SGQQPSLGQQMIFEEHGFRRTTPPTMASPVRHRPRPYPPNVNEEIQIGPVPRGDVDHHLY
PHVLGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGIDEEPLQFRVPGTSASATL
TGLTRGATYNIIVEAIKDQKRHKVREQVVTVGNSVDQGLNQPTDDSCFDPYTVSHYAIGE
EWERLSESGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGESGQMMSCTCL
GNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAE
PGHEGSTGHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
NT seq 7164 nt   +upstreamnt  +downstreamnt
atgctcggggatccggggccccggctgctgctgctgctgaccgtcctgtccctggggaca
gcggtgccctccactggagcctcgaagagcaagaggcaggctcagcaggtcattcagccc
cagtccccgttggctgtcagccaaagcaagcctggttgttatgacaatgggaaacactat
cagataaaccaacaatgggagcgcacctacctgggcagtgccttggtctgcacctgttat
ggagggagccggggctttaactgcgagagcaagcctgaacctgaagagacttgctttgat
aagtacaccgggaacacttaccgggtgggcgacacttacgagcgccctaaggactccatg
atctgggactgcacctgcattggggctgggcgagggagaataagctgcaccattgcaaac
cgctgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacacgag
actggtggttacatgttggagtgtgtgtgtctcggtaacgggaaaggagaatggacctgc
aaacccatagctgagaaatgttttgatcacgctgctgggacttcctacgttgtcggggag
acctgggaaaagccttatcaaggctggatgatggtggattgtacttgtctgggagaaggc
agtggacgcatcacctgtacctccagaaacagatgcaacgatcaggacactaggacatcc
tatagaattggggatacctggcgcaagaaggacaatcgggggaacctgctccaatgcatc
tgcactggcaacggccgtggcgagtggaagtgtgagaggcacacaaccctgcagaccacg
tctgccggatctggctccttcacagacgtccgaacggccatttaccagccacagcctcac
ccccagccggctccgtacggtcactgtgtcacagacagtggtgtggtttactccgtgggc
atgcagtggctgaaggcacaaggaaataagcaaatgctttgcacttgcctgggcaatgga
gtcagctgccaagagacagctataacccagacttatggtggcaattcaaatggggagcct
tgcgtcctaccattcacctacaacggcaggactttctactcctgcaccacagaagggcga
caggatggacatctctggtgcagcacaacttccaattatgagcaagaccagaaatattct
ttctgtacagatcatactgtcttggttcaaactcgaggtggaaattccaatggtgccttg
tgccactttcccttcctgtacaacaaccaaaactacaccgactgtacatccgagggcagg
agggacaacatgaaatggtgtggaaccacacggaactatgacgctgaccagaagtttgga
ttctgccccatggctgcccacgaggaaatctgtacaaccaatgaagggatcatgtatcgc
attggagaccagtgggacaaacagcatgatatgggccacatgatgagatgcacatgtgtt
gggaacggtcgtggagaatggacatgtgtcgcctactcccagctccgagatcagtgcatc
gtagacgacatcacatacaatgtgaatgacacattccacaaacgtcacgaagagggacac
atgctgaattgtacctgcttcggtcagggcaggggccggtggaagtgcgatcccattgat
caatgccaggattcagaatcccgtaccttttatcaaattggagaatcatgggagaagttt
ttgcatggagtcaggtaccagtgctactgctatggccgtggcattggggagtggggctgc
cagcccatacagacctatccaggttcaactggtcctgtccaagtaataatcactgagacc
cccagtcagcccaactctcaccccatccaatggaatgcaccagaaccatctcacatttcc
aagtacattctcagatggaaacctaaaaattctccagaccgttggaaggaagccaccatt
ccgggccacttaaactcctacaccatcaaaggcctgaggccaggtgtggtatacgagggc
cagctcatcagcgtccagcactacggccaaagagagatgacacgcttcgacttcaccacc
accagcacaagcccagtggtgaccagcaacaccgtgacgggagagacaacacccttttct
cctgttgtggccacctccgaatccgtgactgaaatcacagccagcagctttgtggtctcc
tgggtctcggcttccgacactgtgtccggattccgggtggagtatgagctgagtgaagag
ggagatgaaccacagtacttggatcttcccagcacagccacttctgtgaacatccctgac
ctgcttcctggccgaaaatacattgtgaacgtctatcagatatccgaagaaggagaacag
agtttgatcctgtctacctcacagacaacagcacctgatgcccctcctgaccctaccgtg
gaccaggttgatgacacctcgattgtcgttcgctggagcagaccccaggcgcccatcaca
ggatacagaatcgtctactccccatcagtagagggtagtagcacagaactcaaccttcct
gaaactgccaactctgtcactctcagtgacttgcagcctggtgttcagtataacatcact
atctacgctgtggaagaaaatcaagagagtactcctgtcttcatccaacaagaaaccact
ggcgtcccacgttcagataaagttccccctcccagagacctgcagtttgtggaggtgacg
gacgtaaagatcaccatcatgtggacaccccccgagagcgcggtgaccggttaccgagtg
gacgtgatccccgtcaacctgcccggggaacacgggcagaggctgcccatcagcaggaac
acatttgcagaagtcactgggctgtcccctggggtcacctatcacttcaaagtcttcgcc
gtgaaccacgggagggagagcaagcctctgacggcacaacaggcgaccaaattggatgct
cccaccaacctccagtttatcaatgaaactgacaccaccatcatagtgacctggactcca
cctcgtgcccggatagccgggtaccgactgactgtgggcctgacccgtggaggccagccc
aagcagtacaacgtaggtccctcgtccacgcagtacccactgaggaatctgcagcctggc
tccgagtactctgcaaccctcgtggccgtgaaaggcagccagcagagccccagagccact
ggagtcttcaccactctgcagcctctgagctccatcccaccttaccacacagaagtgact
gaaaccaccattgtgattacatggacacctgctccaaggattggttttaagctgggtgta
cgaccaagccagggaggggaagcaccacgagaagtgacctcagagtcaggaagcatcgtt
gtgtctggcctgactccaggcgtggaatacatttacaccatctcagtcctgaaagacggg
caagagagagatacaccaattgtgaagaaagtggtgacaccactgtctccaccaaagaac
ttgcacctggaaacaaaccccgacactggcgtgcttactgtctcctgggagaggagtacc
accccagacattactggctatagaattaccaccacccctacaaatggtcagcagggatat
tctttggaagaagtggtccatgccgatcagagttcctgcacttttgaaaacctgagtcct
ggcctggagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgtccctatc
tctgataccatcatgccagctgtccctcctcccactgacctgcgatttaccaatgttggt
cccgacacgatgcgtgtcacctgggccccacctccatccattgaattgaccaacttactg
gtgcgctactcgcctgtgaaaaatgaggaggatgttgcagaattgtcagtttctccttca
gacaatgcagtgttcttaacaaatctcctgcctggaacagagtatttagtcagcgtctcc
agtgtttacgagcagcatgagagcgtacctcttagaggaagacagaaaactggtctcgat
tccccaactggcattgacttttctgatatcactgccaactctttcactgtccattggatt
gctcctcgagctaccatcactggctacaagatccgccatcatcctgagcacatgggtgga
agacctcgggaggatcgagtgcccccctctcggaattccatcacactcaccaatctcaat
ccgggcacagattatgtggtcaccattgtcgctcttaatggcaaagaggaaagcccttcc
ttggttggccagcaaacaacagtttctgatgttccaagggacctggaagtcattgctgca
acccccactagcctgttgatcagctgggatgctccggccgttacagtgagatattacagg
atcacctatggagaaacaggaggaaatagccctgtccaggagttcactgtgcctgggagc
aagtctacggctaccatcagtggtcttaaacctggagcagactacaccatcactgtttat
gctgtcactggccgtggggacagcccggcaagcagcaagcccatttccattgattaccga
acagaaattgacaaaccatcccagatgcaagtgactgatgtccaggacaacagcattagt
gtcaggtggctgccttcaagttcccctgttaccggttacagggtgaccactactcctaaa
aatggcccaggaccatcgaaaacaatgactgcaggtccagatcaaacggaaatgacaatt
gaaggcttgcagcccacagtggagtatgtggttagtgtctacgctcagaatcgaaacgga
gagagtcagcctctggttcagacagcagtaaccaacattgatcgccctaaaggactggca
ttcactgatgtggatgtcgattccatcaaaattgcttgggaaagcccacaggggcaagtt
tccaggtacagggtgacctactcgagccctgaggatggaatccatgagctattccctgca
cctgatggtgaagaagagactgcagagctgcaaggcctcaggccgggttctgagtacaca
gtcagtgtggttgccttgcacgatgatatggagagccagcccctgattggaacccagtcc
acagccattcctgcaccaaccaacctgaagttcactcaagtttcaccaaccagcctggcc
gcccagtggacggcacccaatgttcagctcactggatatcgagtgcgagtgacccctaag
gagaagaccggaccaatgaaagaaatcaaccttgctcccgatagctcatctgtggtggta
tcaggactcatggtggccactaaatatgaagtgagcgtctatgctctaaaggacactttg
acaagcagaccagctcagggagtcgtcacgactctggagaatgtcagccctccaagaagg
gcccgtgtgacagatgctactgagaccgccatcaccattagctggagaaccaagactgag
acgatcaccggcttccaagtcgatgccatccccgccaacggccagactccgattcagaga
accatcaagccagatgtcagaagctacaccatcacaggtttacaacccggcactgactac
aagatccacttgtacaccttgaatgacaatgcccggagctcccctgtggtcatcgacgcc
tccactgccattgatgcaccatccaacctgcatttcctggccaccacacccaactccctg
ctgttatcatggcagccacctcgtgccaggattactggttacatcatcaagtatgagaag
cccgggtcccctcccagagaagtggtccctcggccccgccctggtgtcacagaagctact
attactggtctggaaccaggaatcgagtacacaatccaagtcattgccctcaagaacaat
cagaagagtgagcctctgatcgggaggaaaaagacagatgagcttccccaactggtaacc
cttccacaccccaatcttcatggaccagagatcctggatgttccctccacagttcaaaag
acccctttcatcaccaaccctgggtatgacactggaaacggtattcagcttcctggcact
tctggtcagcagcccagtcttgggcaacaaatgatctttgaggagcatggttttaggcga
accacaccgcccacaatggccagccccgtaaggcataggccaagaccgtatccaccgaat
gtaaatgaggagatccaaattggtcctgtccccaggggagacgtagaccatcatctctac
cctcacgttctgggactcaatccaaatgcttctacaggacaagaagctctctctcagaca
acaatctcatggaccccattccaggaaagctctgagtatatcatttcatgtcatccagtt
ggcattgatgaagaacccttgcagttccgagttcctggaacttctgctagtgccaccttg
acgggtcttaccagaggggccacctacaacatcatagtggaggcaataaaagaccagaag
aggcacaaggttcgggagcaagtagttaccgtgggcaattctgttgaccaaggcctaaac
caacccacggatgactcgtgcttcgacccctacacggtttcccattatgccattggagag
gagtgggagcgattgtctgaatctggctttaaactctcatgccagtgcttaggctttggc
agtggtcatttcagatgtgattcatctaaatggtgccatgataatggtgtgaactacaag
attggagagaagtgggatcgtcagggagaaagtggccagatgatgagctgcacgtgtctt
ggaaatggaaaaggagaattcaagtgcgatccccatgaggcaacgtgttacgacgatggg
aagacgtaccacgtgggagaacagtggcagaaagaatatcttggtgccatttgctcctgc
acgtgctttggaggccagcggggctggcgctgtgacaactgccgcagaccaggggctgaa
cccggtcacgaaggctcaactggccactcctacaaccagtattcgcagagataccatcag
agaacaaatactaatgtcaactgcccaattgagtgcttcatgcctttagatgtacaggct
gacagagaagattcccgagagtaa

KEGG   Delphinapterus leucas (beluga whale): 111171889
Entry
111171889         CDS       T05885                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04974  Protein digestion and absorption
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111171889 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111171889 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111171889 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111171889 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    111171889 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171889 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111171889 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111171889 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111171889 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111171889 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111171889 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111171889 (COL4A4)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111171889 (COL4A4)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111171889 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 111171889
NCBI-ProteinID: XP_022423554
UniProt: A0A2Y9MMP1
LinkDB
Position
Unknown
AA seq 1686 aa
MALVRRSFRWIKPLATDSRLLVLILFSVQHAYGGGKKFIGPCGGRDCSLCQCFPEKGSRG
PPGPPGPQGPIGPLGPPGPIGIPGEKGMRGDSGLPGAAGDKGDKGPTGVPGFPGLDGIPG
HPGPPGSRGKSGIDGYNGSRGAPGFPGERGAPGPQGSPGLLGKKGEKGNSVFILGVIKGI
QGDRGDPGPPGLPGSRGVRGPAGPVGYPGEPGLAGPPGPPGSPGLKGNPGVGVKGQMGDP
GEVGQQGSPGPTLLVQPPDSGLYKGEKGIKGTPGIIGPPGPPGPKGEPGIGTKGEKGIPG
FPGPRGDPGFYGSPGFPGLKGEPGVFGDPGPFGYLGPKGDPGDRGHPGPPGFLATPALPL
KGPPGDPGHPGRYGETGAVGPPGPPGPPGRPGEVCAGMMGPPGPRGFPGHPGFPGAAGIP
GRADSAPGKPGNQGPPGLPGVPGLPGPPGSDVVYCSAGPPGPQGIKGKVGPPGRRGSKGE
KGSTGLCACQPGPSGPPGPPGLPGRQGSKGDLGLPGRLGEKGYPGLPGARGSPGPPGKPG
TSGPPGSKGEKGDLVVSRVKGRKGERGPDGPPGFPGQQGQHGRDGYAGEKGDPGPLGDHE
DAAPGDKGPPGPPGPPGRAGPRGPPGLGFPGPPGERGQPGAPGCPGKRGPDGWKGQKGDT
IPCNVTYPGRPGPPGFDGPPGPKGFPGRRGVPGLRCLDGEKGQRGKPGISEIPGPPGFPG
DMGDPGFGGEKGSSPVGPPGSPGSPGVNGQKGPPGDSAVGYPGPPGKRGLLGVPGSKGLR
GDPGRPGAAGPAGMPGFPGLKGPKGREGSAGFPGIPGPPGHSCERGAPGRPGPPGLPGAP
GSPGAPGWKGQQGDTGPPGPAGMKGLPGVPGRPGTDGPPGPPGVPGPSGDDALPGLPGPK
GPQGLPGFLGFPGERGKPGPDGHPGRKGEHGEQGWPGSLGERGVKGDKGARGPPGYEGEM
DIILKKGETGEPGPPGDGGFPGEEGDKGHPGIQGKKGEPGSCGPPGFHRGEPGRKGQPGL
PGPPGPPGSPGLRGLIGFPGFPGDQGEPGSPGPPGLSGIDGTRGPKGYKGEPASQFGLPG
PKGEPGSPGYPGHLGAPGEQGLPGVQGPGGLPGRPGLPGSSGPAGCPGNPGLPGLQGHPG
EMGDPGPRGLVGDPGAPGLPGIKGPSGSPGLNGLHGLKGQKGSKGTSGSHKTGPPGPVGM
PGPKGETGDPGSPGISPPGLFGDKGPPGPPGRPGPPGPAGAPGRALKGDIPDPGLPGDQG
PPGPNGPRGIPGPPGPPGRVELLKGEPGDCGLPGPPGPPGPPGPPGRKGFPGCDGKDGQK
GPIGFPGLQGPPGTPGPPGEKGLPGPPGRQGPLGPPGSRGEPGPPADVDACPRIPGLPGV
PGPRGPEGTMGLPGMRGPPGPGCKGEPGLDGRRGEDGLPGSPGPPGHKGDMGEAGCPGVP
GPPGPVGDPGPEGFGPVDPSGFLLVLHSQTDGEPTCPAGMPRLWTGYSLLYLEGQERAHN
QDLGLAGSCLPMFSTLPFAHCNIHQVCQYARRNDRSYWLASAAPLPMTPLSEEEIRPYLS
RCAVCEAPAQAVAVHSQDQSVPPCPRAWRGLWIGYSFLMHTGAGDQGGGQALMSPGSCLE
DFRAAPFLECQGRQGTCHFFANEYSFWLTTVRPDLQFSSAPSPDTLKESQAQRQKISRCQ
VCVKHS
NT seq 5061 nt   +upstreamnt  +downstreamnt
atggcattggtaaggcgctctttcaggtggatcaagcccttggccacagattcccggttg
cttgtacttattctcttttctgtacaacatgcgtacgggggtggaaagaaatttattggt
ccctgcgggggaagagattgctctctttgccagtgctttcctgaaaaggggtctcggggt
ccaccaggaccaccagggccacagggtcctattggacccctggggccaccaggacccatt
ggaattccaggagagaaagggatgagaggtgacagtggccttcctggagcagcaggtgac
aagggtgataagggtccaaccggtgttcctggattcccgggtttggatgggatacctggg
cacccagggcctcctggatccagaggcaaatctggcatagatggctacaacggctcaaga
ggtgccccaggctttccaggagaaagaggagctcctggcccacaaggctccccaggcctt
cttgggaaaaaaggagaaaaaggaaattcagtgttcattttaggtgtcattaaaggtatt
cagggtgacagaggggacccaggacctcccggcttaccaggctcaaggggagtgagagga
ccagcaggcccagtgggatatccaggagagccggggttggcaggacctccaggccctcct
gggagtccaggtttgaagggtaatcctggcgtgggagtaaaggggcaaatgggagacccg
ggtgaggttggccaacagggttctccaggacccacccttctggtgcagccacctgattct
ggtctctataaaggagaaaagggtattaaaggaacgcctggaatcattggacctcccgga
ccaccaggccccaagggggaacccggtattgggacaaaaggagagaaaggtattcctgga
tttccaggacctcggggggaccctggcttctatggatctccaggttttccaggattaaag
ggggaaccaggagtgtttggagatcctgggccgtttggatatcttggtccaaagggagat
cctggagaccgcgggcacccaggaccaccagggtttttggcaactccagctcttccactc
aaagggcctccaggggatccagggcaccctggccgctatggagaaacgggggctgttgga
ccacctggtccccctggtccccctggtagaccaggggaagtctgtgcaggcatgatggga
ccccctgggccacgagggtttcctggtcatccaggatttccaggggcagctggtattcct
gggagagctgattctgctccagggaaaccaggcaaccagggaccacctgggttgcctgga
gtgccagggttgccgggacctccaggatcagatgttgtatattgtagtgctgggcctcct
ggaccacaaggaataaaaggcaaagtgggtcctccaggaagaagaggctcaaaaggagaa
aaaggaagcacagggctctgtgcctgccagcctggtccctcaggcccacccggccctcca
ggacttcctgggaggcaagggagtaaaggagacttgggactccctgggcgacttggagaa
aaaggttacccaggccttcctggtgccagaggatctccagggccaccaggaaaacctggt
acctcaggaccacctggcagcaaaggagaaaaaggtgacctggttgtatcaagagtgaaa
gggcgcaaaggagaaagaggtcctgatgggcccccaggatttccagggcagcagggacaa
cacggtcgagatggatatgctggagaaaaaggggacccaggaccgctgggagatcatgaa
gatgcagccccaggtgataaagggcctcctggaccaccaggccccccgggcagagcagga
cctagggggcctccgggactgggatttcctggtccaccaggagagagagggcaaccagga
gctccaggctgcccaggcaagaggggccctgatggctggaagggtcagaaaggtgataca
attccttgtaacgtaacctaccctgggaggccaggcccgccaggttttgatggacctcca
ggtccaaagggatttccaggtcgtcggggagttcctgggttgaggtgtctggatggggaa
aagggtcaacgtggcaaaccaggaatctcagaaatacctggtccacctggttttcctggt
gatatgggagatccaggttttggaggtgaaaaggggtcctcccctgtcgggcccccaggc
tctccaggttcacctggagtgaatggtcagaaaggacctccaggagactctgctgttggc
tacccaggacccccaggaaagaggggtcttttaggagtaccagggtcaaaaggactcaga
ggtgatcccggacgaccgggggctgcagggccagctggcatgcccggattcccgggtctc
aaaggtcccaaagggagagagggaagtgctgggtttccagggatcccaggtccacccggc
cattcctgtgaaagaggcgctccagggagaccagggccaccagggctccctggagctcca
ggaagtccaggtgccccaggttggaaaggacaacaaggggacacggggcctcctggaccc
gctggaatgaagggcctccctggagtcccaggacggccagggacagatggacccccaggg
cccccgggagtcccaggccccagtggggatgatgcgctacctggtcttccaggcccaaag
ggaccccaggggctacccggcttcctgggttttccgggagagagaggaaaacctggcccg
gacggacaccctggcagaaagggagaacacggagaacagggttggcccggctccctggga
gagcgaggagtgaaaggtgacaaaggagcaagaggacccccaggatatgaaggagaaatg
gatattattttgaaaaagggggaaaccggggaacctggacctcctggagatggtggattc
ccaggagaagaaggtgataaaggccatcctgggatacaagggaagaaaggagagccagga
agctgtggaccacctggatttcacagaggggagcctgggaggaaagggcagccaggcctt
cctggacccccaggccctccaggctcacctgggctgagagggctcattggctttccggga
tttccaggtgaccagggtgagccaggttctccagggccccctggactttcaggaattgat
ggtacaagaggacctaaaggatacaaaggggaacctgcaagtcagtttggcctacctggt
ccaaagggtgagccaggtagccctggatatccaggacatttgggagcacctggagagcag
ggcttgcctggtgttcaaggacctggaggactacccggaaggccaggactgcctggctcc
tctggaccagcggggtgtccaggtaatccagggctgcctgggctgcagggacatccagga
gaaatgggggatcctgggccaagaggcctcgtgggggatccaggggcaccaggtcttccg
ggaataaaaggtccctccgggtcgcctggcctgaacggcttgcacggtttaaagggtcag
aagggcagcaaaggcacttcaggttcccataaaacgggcccacctggtccagtgggaatg
cccgggccaaaaggcgagacaggagaccccgggagcccaggaatttctcctccaggactt
ttcggagacaaaggtcccccaggtcccccagggagacctggaccgcctggtcctgcgggt
gccccaggaagagctcttaagggtgacattccagacccgggtctgcctggagatcaggga
cctcctggccccaatggtccaagaggaatacccgggcctccagggccccctgggagggtt
gaacttctgaaaggtgaaccaggtgactgtggtctgccggggcctccaggtcccccaggc
ccaccaggccctccaggacgcaaaggcttcccaggatgtgatggaaaagatggccagaaa
ggaccaataggattcccggggctgcaggggccacctggaactcctgggccacctggagag
aagggtttacctggacctccaggcagacaggggcccttgggtcctccaggttccagaggt
gaacctgggccccctgcagacgtggatgcttgcccccgaatcccagggcttcctggggta
ccaggcccaagaggaccagaaggaaccatggggctccccggaatgagaggccccccagga
ccagggtgcaaaggagagcccgggctggatggcaggagaggcgaggatggccttccaggg
tcccctgggcctccaggacacaaaggtgacatgggagaagcaggctgcccaggagtacca
ggccctcctgggcccgtgggggatcctgggcccgaagggttcggccctgtagaccccagt
ggcttcctcctggttctccacagtcaaactgatggagaacccacctgccccgcgggcatg
cccaggctctggactgggtatagtctgttatacctggaaggacaggagagagctcacaat
caagaccttggtctggcgggctcctgcctccccatgttcagcacgctgcccttcgcccac
tgcaacatccaccaagtgtgccagtacgcccggaggaacgacaggtcctattggctggcg
agcgccgcgccgttgcctatgacgccgctctcggaggaggagatccgcccgtacctcagc
cgctgcgccgtgtgcgaggcccccgcgcaagccgtggctgtgcacagtcaggaccagtct
gtcccgccgtgtccgcgggcctggaggggcctctggattgggtactctttcctgatgcac
acaggcgctggggaccaaggaggcggccaggccctcatgtcacccggcagctgcctggag
gatttcagagctgcaccgttccttgaatgccaaggacgtcagggaacttgccactttttt
gcaaatgagtatagcttctggctgacaactgtgagacctgacttgcagttttcctcagca
ccctcaccggacaccttgaaagaaagccaagcccagcgccagaaaattagcaggtgccag
gtctgtgtgaagcatagctag

KEGG   Delphinapterus leucas (beluga whale): 111171891
Entry
111171891         CDS       T05885                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04974  Protein digestion and absorption
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111171891 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111171891 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111171891 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111171891 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    111171891 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171891 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111171891 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111171891 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111171891 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111171891 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111171891 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111171891 (COL4A3)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111171891 (COL4A3)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111171891 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 111171891
NCBI-ProteinID: XP_022423555
UniProt: A0A2Y9MNJ1
LinkDB
Position
Unknown
AA seq 1670 aa
MRPGTAPRPPALLLLLQLVLLVAAPTAGKGCVCKDKGQCFCDGTKGEKGEKGFPGPPGPP
GQKGYPGPEGLPGPQGPKGSPGLPGFTGPKGVRGTTGLPGFSGPPGLPGIPGHPGPYGPV
GLPGCNGSKGEQGFPGLRGTPGYPGIPGAVGLKGEKGAPAEGEGVALDGKGDPGLPGAPG
FQGLPGLPGFPGPIGPPGPPGFFGFPGTMGPPGPKGHMGDKVIGQKGERGMKGLTGPPGP
PGTVIVTLTGLVNRTDLKGEKGDQGAMGQSGRPGPSGPPGESYGSEKGAPGEPGPQGKPG
KDGAPGFPGTEGAKGSKGFPGLRGEDGIKGWKGDMGPPGFRGPTEYYDAYQEKGDEGIPG
PSGPKGAPGPQGPSGPPGAPGSPGSSRPGLQGAPGVPGAKGSKGERGPPGKSAVGLPGSP
GCPGSPGPTGLPGPAGPPGGIVLHRGPPGDGGPPGHTGSPGIPGVDGPKGEPGLLCTQCP
CVPGPPGPPGLPGLDGVKGFPGRQGAAGIKGIPGSPGSAGLPGFPGFPGDQGHPGLKGEK
GEASQPERQVGAPGDPGLRGHPGRKGLDGIPGTPGVKGLPGPKGEPALSGEKGDQGLPGD
PGIPGSPGPAGPAGPSDYGPWGEPGPKGTQGLPGAPGPPGEAGPKGEIGVLTPVPGPPGP
PGAPGRAGPQGPPGIPGSTGKCDLGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSPG
CPGETGKPGLPGKPGLPGVKGEPGLAMPGEPGAPGLPGERGNSGEKGESGLPGLPGLPGI
PGTGGLDGPRGDPGQPGPPGERGPPGRCKESLSGAQGLPGLNGLKGQQGRRGETGPKGDP
GIPGLDRSGFPGEPGPPGMPGHRGEMGPPGTKGYPGNPGFLGPPGEKGMIGMMGVPGNIG
PPGPPGKPGTLGQRGSFGIPGVKGERGAPGAKGEQGDKGTPGPPGILRLVGDKGEPGLKG
LAGKPGEKGNRGIPGLPGFKGLQGPPGPPGSPDSRGDPGSIGNPGEPGPRGVPGSMGSMG
VPGTKGMKGTMGFPGLAGRPGLPGTHGPQGDKGEPGYSEGTRPGPPGPKGDPGLPGDMGK
KGGRGPPGTPGCSGPAAPEGVPGNPGSPGHPGKPGPDGDLGSKGIKGFPGSPGIKGPPGP
PGFPGNPGPAGERGNQGRDGIPGPAGEKGETGLLGALPGPRGKPGPQGAKGDRGAPGFPG
LPGRKGPVGDAGPRGPIGMTGPQGPPGFPGSIIPGQKGDRGPPGRRGNPGEPGPPGPEGG
PVEGIKGDKGFMGQPGPRGPPGTVGDMGPPGHPGVPGAPGLPGVRGDPGFYGFPGIKGEK
GDSGFLGPSGPPGRIGPKGPPGVRGDPGTVKIISLPGSPGPPGPAGEPGMQGEPGPPGLP
GNPGPCGPRGKPGKDGLPGTPGPIGEKGNKGCKGEQGPPGSDGLPGLKGKPGDTGPPARG
TTMRGFVFTRHSQTTAIPSCPEGTEPLYSGFSLLFVQGNEQSHGQDLGTLGSCLQRFTTM
PFLFCNINDVCNFASRNDYSYWLSTPALMPVDMAPITGRALEPYISRCTVCEGPAIAIAV
HSQTTDIPSCPPGWISLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRG
TCNYYSNSYSFWLASLDPRRMFRKPIPSTVKAGELEKIISRCQVCMKRRH
NT seq 5013 nt   +upstreamnt  +downstreamnt
atgcgccctgggacggcgccgaggccgccggcgctgctgcttctgcttcagctggtgctc
ctggtggccgcgcccactgccggcaagggctgtgtctgtaaagacaaaggccagtgcttc
tgtgatgggaccaaaggggagaagggggagaaaggctttcccggaccccctgggcctccc
ggccagaaaggatacccaggtccggaaggcctgcctggaccacagggacccaagggctct
ccaggacttccaggattcactggtcccaaaggcgtgaggggaacaactggattaccagga
ttttcaggtcctcctggacttccaggcatcccaggccatcctggaccgtatggacctgtc
ggtttgccaggatgcaatggttctaagggtgagcaagggtttccaggacttcgggggaca
ccaggctacccaggcatcccaggtgccgttggtttgaaaggagagaaaggggctcctgct
gaaggagaaggtgtagcccttgatggaaaaggtgaccctgggttgccaggagctccagga
ttccagggtttgccaggccttccaggttttcctggacctattggtccccctggccctcca
ggattctttggctttccaggaaccatgggacctccaggacctaagggtcacatgggcgat
aaagtgataggacaaaaaggagagcggggtatgaaaggattaacaggaccgcccggacca
ccaggaacagttatcgtgacactaaccggcctggtcaacagaacggacctcaagggggag
aagggagaccagggagccatgggccagtctggacgccctggaccctcagggccacctgga
gaatcttacggatcagaaaaaggtgctcctggagaaccaggcccgcagggaaagcctgga
aaagatggtgcccccggtttccctggcactgagggagccaaaggcagcaagggtttccct
gggttaaggggcgaagatggcatcaaggggtggaaaggagacatgggccctccaggattt
cgtggtccaacagaatattatgatgcataccaggaaaagggagatgaaggaattccaggc
ccatcagggcccaagggagctcctggcccacagggtcccagtggtccccctggagcccct
ggaagtcctgggtcatcaaggcctggcctccaaggagcccctggagtaccaggagcaaaa
ggaagtaaaggcgagcgaggacccccaggaaagagcgcagtggggcttcccgggtcccct
ggctgtcctggttcaccaggccctacagggttgccaggacctgcaggaccaccaggtggt
attgttcttcacagaggtccccctggagatggtggacctccaggccatacagggtctcca
ggaatcccgggagtcgatgggcccaaaggggagccaggccttttgtgcacacagtgtcct
tgtgtcccagggcctccaggccccccaggattgccggggttagatggcgtaaaaggattc
ccaggaagacaaggggcagctggcattaaaggaatcccagggtccccaggaagcgctggt
cttccaggatttccgggattcccgggtgatcagggtcatccgggacttaaaggagaaaaa
ggtgaagcatctcagccagagagacaagtgggtgccccaggggatccaggcctccgagga
catcctggaagaaagggcttggatggaattcctggaactccgggagtaaaaggattacca
ggacctaagggagaaccggccctgagtggggagaagggagaccagggtcttccaggggat
cctggcatccctgggtccccaggacctgcaggaccggctggaccatcagactatggacct
tggggagagcctggtccaaagggcacccaaggacttcctggagcccctggaccacctgga
gaagccggtcctaagggagaaatcggtgttttgacaccagttccagggcccccaggacct
cctggagccccaggccgtgctggcccccaaggtccacctggtatccctggatccacagga
aaatgtgatctgggtcttcctgggcccgatggtgaaccaggaattccaggaatcggattc
cctgggcctcctggacctaagggagaccaaggttttccaggaacaaaaggatcaccaggc
tgtcctggagaaacgggaaagccagggttacctggaaagccaggcctcccaggagtcaag
ggagaaccagggctagccatgcctggagagccaggagcaccaggtttgccaggagaaaga
ggcaactctggggaaaagggagaaagtggactccctggacttccaggtctccctggaatt
ccaggaactggagggcttgatggaccacgaggggatccagggcagcctggaccacctgga
gaaagaggccccccaggaaggtgcaaagaaagtctcagtggagctcaaggacttccaggc
ttaaatggattgaaagggcaacaaggcagaagaggcgaaacggggccaaagggagaccca
ggtattccaggcttggataggtcaggatttcctggagaacctggaccaccaggaatgccg
ggtcatcgaggggagatgggaccacctggtacaaaaggatatccaggaaatccaggattt
ttagggccaccaggtgaaaaaggaatgattgggatgatgggggttcccggaaacattggc
cctccggggcctcctgggaagccaggcaccctgggacagagggggagctttggaattcca
ggagtaaaaggcgagagaggagccccaggtgccaaaggggaacaaggagataaaggaact
ccagggcctcctggaatattacgcttggtcggggacaaaggggaaccaggactcaaagga
cttgcagggaagcctggtgagaaaggaaacagaggcattccagggttaccaggtttcaaa
ggactccaagggccacctggaccaccaggatcaccagactccagaggagatccaggcagc
attgggaatcctggtgagccaggaccacgtggtgtgccaggaagcatgggaagcatgggg
gtgccaggtactaaaggaatgaagggaactatgggattcccaggtctagctggaagacca
ggcctcccaggtactcatggtccccaaggagataagggagagccaggttattcagaaggt
acaaggccaggaccaccaggaccaaagggagatccaggattgccaggtgacatgggaaag
aaaggaggtagagggccacctggcacacctggatgttcgggccctgctgcaccagaggga
gttcctgggaatcccggaagccctggccacccaggaaagcccggtcctgatggtgatttg
gggtctaaaggaatcaaaggtttccctggctctccaggaataaaaggccctccaggccct
ccaggattcccaggaaatcctggaccagcgggtgagagaggtaatcaaggacgtgatgga
attcctggtccagctggagaaaaaggagaaacaggtttgctgggagcacttccaggccca
agagggaaacctggtcctcaaggagccaaaggagacaggggagccccaggctttccgggc
ctccctggcaggaaagggccagtgggagatgctgggcctcgagggcccattggcatgaca
ggacctcaagggccaccaggctttcctggttcaatcatccctggccaaaaaggagatcga
ggtccacctggcagaagaggaaacccaggtgagcctggtccccctggacctgaagggggt
cccgtagaaggcataaaaggagacaagggatttatgggccagcctggcccaagaggtccg
cctggaactgtaggagacatggggccaccaggtcatccgggagtaccaggtgccccaggt
ctgccaggggtcagaggtgatcctggattctatggatttccgggcataaaaggggagaag
ggtgattcaggatttctgggaccaagtggacctccagggcgaattgggccaaaaggacca
cctggtgtacgtggagaccctggcacagtgaagatcatctcccttccaggaagcccaggc
ccacctggcccagctggagaaccagggatgcaaggagaacctgggcccccggggctaccg
ggaaacccaggaccctgtgggccaagaggtaaaccaggcaaggatggactaccaggaacc
cctggaccaattggagaaaaaggcaacaaaggttgtaaaggagagcaaggaccgcctgga
tccgatggcctgccaggcttgaaggggaaacctggagacactggaccgcctgcaaggggg
acaacgatgaggggctttgtcttcacccggcacagccagaccacggcgattccctcctgt
ccagaagggacagaaccactctatagtgggttttctcttctctttgtacaaggaaatgaa
caatcccatggacaggacctgggaactcttggcagctgcctgcagagatttactacaatg
ccattcttattctgcaatatcaatgatgtatgtaatttcgcatctcgaaacgattattca
tactggctctcaacaccagctctgatgccagtggacatggctccaattactggccgggcc
ctggagccttatattagcagatgcactgtctgtgaaggtcctgcaattgccatagctgtt
cacagccaaactactgatatcccctcatgtcctcctggctggatttctctctggaaagga
ttttctttcatcatgttcacaagtgcaggttcagagggcgctgggcaggcactggcatcc
cccggctcctgcttagaagaattccgagccagtccatttatagaatgtcatggaagagga
acatgcaactactattcaaattcctacagtttctggttggcttcattagaccccagaaga
atgttcagaaaacctattccgtcaactgtgaaagctggggagttagaaaagataataagt
cgctgtcaggtgtgcatgaagaggagacattga

KEGG   Delphinapterus leucas (beluga whale): 111174406
Entry
111174406         CDS       T05885                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111174406 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111174406 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111174406 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174406 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111174406 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111174406 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111174406 (LAMB2)
   05145 Toxoplasmosis
    111174406 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Sec5
Other DBs
NCBI-GeneID: 111174406
NCBI-ProteinID: XP_022428883
UniProt: A0A2Y9NHX4
LinkDB
Position
Unknown
AA seq 1812 aa
MPWVWLGAWARMERAAGEQGRDLRGQPGPWQLLLGLLLSVPATALAQALAPDVPGCSRGS
CYPATGDLLVGRADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSH
RIQNVVTSFTPQRRAAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSA
DFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAI
PIPDPYSPWIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCY
GHASQCAPAPGAPAHAEGMVHGACICKHNTRGFNCEQCQDFHHDLPWHPAEDGHSHACRK
CECHGHTYSCHFDMAIYLASGNVSGGVCDGCQHNTAGRQCELCRPFFYRDPTKDLRDPAV
CRSCDCDPMGSQDGGRCDPHDDPALGLVSGQCRCKENVVGSRCQQCRDGFFGLSASDPLG
CQQCQCDTRGTVPGGTPCDRNSGACFCKRLVTGRGCNRCLPGHWGLSHDLLGCRPCDCDV
GGALDPQCNEATGQCHCRQNMVGRRCEQVQPGYFRPFLDHLTWEAEEARGQVPDVVARLV
TPGGIPSWTGPGFVRLREGQALEFLVASVPRAMDYDLLLRLEPQVPEQWAEMELTVQRPG
PVSAHSPCGHVLPKDDHIPGTLQPGTRYMVFPRPVCLEPGISYKLHLKLVRTGGGAQPEA
PYSGPSLLIDSLVLLPRVLVLEMFSGGDAASLERRATFEHYRCHEEGLVPSKTLPSEACA
PLLISLSTLVYNGALPCQCDPQGSLSSECNPHGGQCLCKHAVVGRRCDLCAPGYYGFGPT
GCQACQCSPEGALSGLCEATNGQCPCQTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADEC
DPHTGACLGCRDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSWRHFATSCHRD
GYSQQIVCHCREGYTGLRCEACAPGHFGDPSRPGGQCQPCECSGNIDPTDPDACDSHSGQ
CLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNLLGTDPQQCPSTDRCNCEPSSGQCP
CLPNVQGPSCDRCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCS
ECQELHWGDPGLQCRACDCDPRGIDTPQCHRSTGHCSCRLGMSGVRCDQCARGFSGVFPA
CHPCHACFGDWDRVVQDLAARTRRLEQWAQELQQTGVLGAFESSFWHMQEKLGTVQGIVG
ARNASAASTAQLVEATEELRREIGEATEHLTQLEAELTDVQDKNFNANHALSSLERDGLA
LNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSLSAEAERRANMSALTVPSPVSNSAGTRH
RTEVLMGARKKDFNHKHMANQQALGELSARTHALSLTGINELVCGSPGDAPCATSPCGGA
GCRDEDGQPRCGGLSCSGAAAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGE
AQQRAQAALDKANASRGQVEQANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIP
ASPEQIRHLAGEIAERVRSLADVDTILAHTVGDVHRAEQLLKDAQRARSRAEGEKQKAET
VQAALEEAQRAQGAAQGAIQGAVVDTQDTEQTLHQVQERMADTEKALSSAGERAQQLDGL
LEALKLKRAGNSLAASSAEETAGSAQGRAREAEQLLKGPLDDQYQTVRALAERKAQGVLA
AQARAEQLRDEARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQA
INLQVQIYNTCQ
NT seq 5439 nt   +upstreamnt  +downstreamnt
atgccttgggtgtggctgggagcctgggcaaggatggagcgggccgcaggggaacaaggg
agggacctgcggggacagcctgggccctggcagcttctactgggcctgctgctgagcgtg
ccggccaccgccctggcccaggccctggccccggatgtgccaggctgttcgcggggaagc
tgctaccccgccacaggggacctgctggtgggacgtgctgacagactgaccgcctcatcc
acctgtggcttgcatgggccccagccctactgcatcgtcagtcacctgcaggacgagaag
aaatgcttcctgtgtgactcccggcgccccttctctgctagagacaacccaaacagccat
cgcatccagaatgtagttaccagcttcacaccacagcgccgggcagcctggtggcagtca
gagaatggtgtccccgtggtcaccatccagctggacttggaggctgagttccatttcacg
cacctcattatgaccttcaagacgtttcgccctgctgccatgctggtggagcgctcagca
gactttggacgcacctggcacgtgtacagatatttctcctatgactgtggggctgacttc
ccaggagtcccactggctcccccacggcactgggatgacgtagtctgtgagtcacgctat
tcagagattgagccatccactgaaggcgaggtcatctatcgtgtgctggaccctgcaatc
cctattccagacccctatagcccatggatccagaacctgctaaagatcaccaatctacgg
gtgaacctgacacggctacacacgctcggggacaacctgcttgacccacggcgggagatc
cgcgagaagtactattatgccctgtatgagctggttgtgcgtggcaactgcttctgctat
ggacacgcctcacagtgtgcacccgccccaggggcaccagcccatgctgagggcatggtt
catggggcctgcatctgcaaacacaacactcgtggcttcaactgtgagcagtgtcaggat
ttccatcatgatctgccctggcatccggctgaggacggccacagtcacgcctgcaggaag
tgtgagtgccatgggcatacctacagctgccacttcgacatggccatatacctggcatct
ggcaacgtgagtggaggtgtgtgtgatgggtgtcagcacaacacagctgggcgccagtgt
gagctctgccgacccttcttctaccgtgacccaactaaggacctgcgagacccagccgtg
tgtcgctcctgtgactgtgaccccatgggttcccaagacggtggtcgctgtgatccccat
gatgatcctgcactggggctggtctcgggccagtgtcgctgcaaagaaaatgtggtgggc
tctcgctgccagcagtgccgtgatggcttctttgggctcagtgccagtgaccctctaggc
tgccagcaatgtcagtgtgatacacggggcacagtgccagggggcaccccttgtgaccgc
aacagtggagcctgtttctgcaagcgtttagtgactggacgtggctgcaaccgctgcctg
cctggccactggggcctgagccacgacctacttggctgccgtccgtgtgactgtgatgtc
ggtggtgccctggatccccagtgcaacgaggccacaggtcagtgccactgccgccagaac
atggtggggcgacgctgtgagcaggtgcagcctggttacttccggcccttccttgaccac
ctaacttgggaggctgaggaagctcgggggcaggtacctgatgtggtggcacgcctggtg
acccctggggggattccatcttggactggcccaggctttgttaggctgcgggaaggccag
gcactggagttcctggtggcctctgtaccaagagccatggactatgacctactactgcgc
ttggagccccaggtacctgagcaatgggcagagatggaactgactgtgcagcgcccaggg
cctgtatctgcccacagcccatgtgggcacgtgctgcccaaggatgaccacatcccaggg
actctgcaaccaggcaccaggtacatggtgtttcccagacctgtctgccttgagcctggc
atctcctacaagctgcatctcaagctggtgcgaacaggaggaggtgcccagcctgaggcc
ccctattctggacccagcctactcattgactcgctggtgctgctgccccgtgtcctggtg
ctggagatgtttagtgggggtgatgcggcttctctggagcgccgtgccacctttgaacac
taccgctgccacgaggagggtctggtgcccagcaagacccttccctctgaggcctgcgcc
cccctcctcatcagcctgtccacactggtctacaacggagccctgccctgtcagtgtgac
ccccagggctcactgagctctgagtgcaacccccatggtggtcagtgcctgtgcaaacat
gcagtggttgggcgtcgctgtgacctctgtgcccctggctactatggctttggccccaca
ggctgtcaagcctgccagtgcagccctgagggggcactcagcggcctgtgtgaagcaacc
aatgggcaatgcccctgccaaactggtgcatttgggcttcgctgcgaccgctgccagcgt
ggccagtggggattccctagctgccggccgtgtgtctgcaacgggcatgcagacgaatgt
gacccccacacaggcgcttgcctgggatgccgtgaccacacagggggtgagcactgtgaa
aggtgcattgctggcttccacggggacccacggctgccatatgggggccagtgccggccc
tgtccctgccctgaaggccccgggagctggcggcactttgctacttcttgccatcgggat
gggtactcccagcagatcgtgtgccactgcagggaaggctacacagggctgcggtgcgaa
gcttgtgcccctgggcactttggggacccatcaaggccaggcggccagtgccaaccatgc
gaatgcagtggtaacattgaccccacggaccctgatgcctgtgactcccactcggggcaa
tgcctgcgctgcttacaccacacagaggggccgcactgtgcccactgcaagcctggcttc
catgggcaggctgcccgacagagctgtcaccgctgcacctgcaacctgctgggcacagat
ccccagcagtgcccatccactgaccggtgcaactgtgagccaagcagtgggcagtgccca
tgcctccccaatgtccagggccctagctgtgaccgctgtgcccccaacttctggaacctt
accagtggccatggctgccagccctgtgcctgccacccaagccgagccagaggccccacc
tgcaatgagttcacaggacagtgccactgccgtgctggcttcggtgggcgaacctgttct
gagtgccaggagctccactggggagaccctgggttgcagtgccgcgcctgtgattgtgac
cctcgtgggatagacacacctcagtgtcaccgttccacaggtcactgcagctgccgcctg
ggcatgtctggcgtgcgctgtgaccagtgtgcccgtggcttctcgggcgtctttcctgcc
tgccacccctgccacgcatgcttcggggactgggaccgtgtggtacaggacctggctgct
cgtacacggcgcctggagcagtgggcgcaggagctgcagcagacgggtgtgctgggtgcc
tttgagagcagcttctggcacatgcaggagaagctgggcactgtgcaggggattgtcggt
gcccgtaacgcctcagctgcctccactgcacagctcgtggaggccacagaggagttgcgg
cgtgaaattggggaggccactgagcacctgacccagctggaagcagagctcacagatgtg
caggacaagaatttcaatgccaaccatgcactaagcagtctagagcgagacgggcttgca
cttaatctcacactgcggcagcttgaccagcatctggacctgctcaagcattcaaacttc
ctgggtgcctatgacagcatccgccatgcccacagcctgtctgcagaggcagaacgtcgt
gccaacatgtcagccctgacagtgcccagcccggtgagcaactcagcaggcacacggcac
cggacagaggtgctgatgggtgcccgaaagaaggacttcaaccacaagcacatggccaac
cagcaggcactgggcgagctctctgcccgtacccatgccctgagcctgacaggcataaat
gaactggtgtgtgggtccccgggagatgcaccctgtgctacgagcccttgcgggggtgct
ggctgtcgggacgaggatgggcagccccgttgtgggggcctcagctgcagtggggcagca
gccatggcggatctggcgctgggtcgggcccgccacacacaggcagaactgcagcgggca
ttggcagaaggtggtggcatcctcagccaggtagctgagacccgtcggcaggcaggcgag
gcacagcagcgggcccaggcagccctggacaaggctaatgcttccaggggacaggtggaa
caggccaaccaggaactgcgggaacttatccagagtgtgaaggacttcctcagccaggag
ggggctgatcctgacagcattgagatggtggccacacgggtgctagagctctccatccca
gcgtcacctgagcagatccggcacttggcaggcgagattgcagagcgggtccggagcctg
gcagatgtggacacgatcctggcgcatactgtgggagacgtgcatcgggcagagcagcta
ctgaaggatgcacagcgggcacggagccgggctgagggtgagaaacagaaggcagagaca
gtacaggcagcgctggaggaggcccagcgggcacagggtgctgctcagggtgccatccag
ggggcagtggttgacacacaggacacagagcagaccctgcaccaggtgcaggagaggatg
gcagatacagagaaggcattgagctctgcaggtgagcgggctcagcaattggatggtctc
ctggaggctctgaaattgaagcgagcaggaaatagcttggcagcctctagcgctgaagaa
acagctggcagtgcccagggtcgtgcccgggaagctgaacagctgctgaagggcccacta
gatgaccagtaccagacagtgagggccctggccgagcgcaaggcccagggtgtgctggct
gcacaggcacgggcagaacaactgcgggatgaggctcgcggcttgttgcaggctgctcaa
gacaagctgcagcggctgcaagagctggaaggcacttatgaggagaacgagcgggcgctg
gagggcaaagcggctcagctggacgggctggaggccaggatgcgcagtgtgcttcaagcc
atcaacttgcaggtccagatctacaacacctgccagtga

KEGG   Delphinapterus leucas (beluga whale): 111176383
Entry
111176383         CDS       T05885                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04974  Protein digestion and absorption
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111176383 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111176383 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111176383 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111176383 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    111176383 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176383 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111176383 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111176383 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111176383 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111176383 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111176383 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111176383 (COL4A2)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111176383 (COL4A2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111176383 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 111176383
NCBI-ProteinID: XP_022432480
UniProt: A0A2Y9NEG8
LinkDB
Position
Unknown
AA seq 1760 aa
MDRDQRAASRPALRWWLLLGAVTVGLLAQGVLAGAKKFDVPCGGRDCSGGCQCYPEKGGW
GQPGPVGPQGYTGPPGLQGFPGLQGRKGDKGDRGAPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGPPGYDGCNGTVGDAGYPGPSGSGGFLGPRGPQGPKGQKGEPYALSSEDRD
KYRGEAGVPGLVGFQGPPGRPGPVGQMGPVGAPGRAGPPGPPGPKGQPGNRGLGFYGEKG
EKGDMGQQGPGGIPPDNSYVERPKNDVILPEQYKGEKGSEGEPGRKGISMEGEEGIMGFS
GVRGAPGFDGEKGSPGQKGSRGPDGYQGPDGYPGPKGEMGEPGPPGPPAYSPHPSLAKGA
RGDPGFHGAPGDPGARGEPGDLGLPGQPGTSIGDEDEKRGLPGEMGPKGFTGEPGIPALY
PGLPGADGKPGLRGPPGFPGPPGPDGFLFGLKGAEGRVGYPGPSGFPGARGQKGWKGDAG
DCQCAEGDQFIGGLPGPPGPKGFPGTNGEPGRKGSPGDPGQHGIPGFPGFKGAPGGVGPP
GPKGMKGDSRTITTKGERGQPGVPGVPGLKGDSGIPGRDGLDGFPGLPGSPGDGIKGPSG
DAGHAGPPGTKGIPGERGPPGLGLPGPKGERGFPGDAGLPGPPGFPGPPGAPGTPGQIDC
DTGVKRPIGADGQETVQPGCVGGPKGSPGQPGPPGPPGAKGLRGLPGLSGTDGAQGLKGL
PGDPGPEGFPGPPGFVGPRGVKGAVGRPGLDGLPGPSGLPGPVGPPGDRGLPGEVLGAQP
GPRGDTGLPGRSGLKGPPGERGPPGFRGSQGMPGIPGPKGQQGFPGPSGQPGLPGPPGQH
GYPGAPGREGPLGPPGTPGFGGLPGDRGEPGDTGVPGPVGMKGVSGDRGDPGWQGERGHP
GSPGFKGVAGMPGAPGPKGVKGSPGMDGFQGMLGLKGRSGLPGNKGETGFFGVPGLKGLA
GEPGVKGSRGDPGPPGPPPSILPGMKDIKGEKGDEGPMGLKGYLGLKGLPGMPGIPGLSG
VPGLPGKPGYVKGVKGDTGFPGVPGSPGFPGVPGSPGISGFPGFTGSRGDKGAPGRVGLH
GEIGPIGDFGDIGNTIDLPGSPGLKGEGGTAGAPGLKGFFGEKGSEGDVGFPGITGLAGV
QGPPGLKGQTGFPGLTGLQGPQGESGRAGVPGTKGDYGWPGSPGLPGLPGLRGIGGLHGL
PGTKGFPGSPGADIHGDAGLPGPAGARGDPGEANTLPGPAGAPGRKGERGVPGERGPVGS
PGLQGFPGITPPSNVSGLPGDVGAPGIFGLEGYRGPPGPPGPVALPGIKGDEGSPGAPGN
PGTKGWVGDSGPQGRPGVFGLLGEKGPRGEQGFMGNTGAAGSVGDRGPKGPKGDRGLPGA
PGAVGAPGIAGIPQRVAIQRGPVGPQGRRGPPGPQGEMGPQGRPGEPGRSTAAGPPLVSC
LLCFHFCSPAGKHWLSTSDGASHSSRGTDTCLGGSAGFRGTPGKAGPQGRGGVSAVPGFR
GDQGPVGLQGPVGYEGEPGRPGSPGLPGMPGRSVSIGHLLVKHSQTEQDPMCPVGMNKLW
SGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDICYYASRNDKSYWLSTTAP
LPMMPVAEEDIRPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAG
DEGGGQSLVSPGSCLEDFRATPFIECNGARGTCHYYANKYSFWLTTIPEQSFQGTPSADT
LKAGLIRTHISRCQVCVKNL
NT seq 5283 nt   +upstreamnt  +downstreamnt
atggaccgagaccagcgcgcggcgtcgcgccctgccctgcggtggtggctactgctggga
gctgtgacagtggggctcctggcccagggcgtcctggcgggcgcgaagaagttcgatgtg
ccctgtggagggagagactgcagtgggggctgccagtgctatcccgagaaaggaggatgg
ggccagccagggccagtgggcccacagggatacaccgggccccccggcttacaagggttc
ccaggactgcaaggccgcaaaggtgacaagggtgataggggggctcccgggatcacagga
ccgaagggagacgtgggagccagaggcgtttctggatttcccggtgccgatggaattccc
ggacatcctggccagggcgggcccagaggaccgcctggctacgacggctgcaacgggaca
gtgggtgacgcaggctacccgggacccagcggctctggcggcttcctcggcccccgtggg
ccccaaggacccaaagggcagaaaggcgagccctacgctctgtctagtgaggaccgcgac
aaatacaggggggaagctggagtgcccggactggtcggtttccaggggcctcccggccgc
cctgggcctgtgggacagatgggtccggttggagctccaggaagagcaggaccccctgga
ccccctggaccaaaaggacagccaggcaacagaggacttggtttttacggagaaaaagga
gaaaagggcgacatgggacagcagggacccggtgggattccaccagacaacagttacgtc
gagaggcccaaaaatgacgtgatcctcccagagcagtataagggtgaaaaaggaagtgag
ggggaaccaggaagaaaaggcatttccatggagggagaagaaggaatcatgggcttttca
ggagtgcggggtgcccctggcttcgatggtgagaaaggttcaccgggacagaaaggaagc
agaggaccggatggttaccaaggccctgatggatacccaggacccaagggagaaatgggt
gaaccaggcccccccggcccaccagcctactccccgcatccttccctggccaaaggtgcc
agaggggacccaggattccatggagcccccggggacccaggagcccggggggagcctgga
gacctcggcttgccaggccagcctggtacatccatcggagatgaagatgagaagagaggc
ttaccgggcgagatgggacccaaaggcttcacaggagagccgggcatccccgccctgtac
cccggcctgccgggagctgacggaaagccagggctccgaggtcccccagggttcccggga
ccacctggcccagacggtttccttttcggccttaaaggagcagagggcagggtgggctac
cctggaccttctggtttccccggggctcgcggacagaaaggatggaaaggcgatgccggc
gactgtcaatgtgcagagggtgaccagttcattgggggtcttccggggccaccaggaccc
aagggctttcccggcaccaatggggaaccagggaggaaaggcagcccgggagaccccggc
cagcacggcatccccgggttcccaggattcaagggagcccctggtggtgttggccctccc
gggcccaaaggaatgaagggagattctcgaaccatcaccaccaaaggtgagcggggccag
ccaggtgtcccaggtgtgcctggactgaaaggggacagcggcatcccaggccgtgatggg
ctggatggattcccaggcctcccaggctctcccggtgatggcatcaaaggcccctcaggg
gacgcaggccacgcaggaccccccggtactaagggcattccaggagaaaggggcccccca
ggattggggctgccaggccccaaaggcgagcgtggcttccccggcgatgctggattacct
ggacctccaggcttccccgggcctcccggcgcccccggcactccaggacaaatagattgt
gatacgggtgtgaaaaggcccatcggagcagatggacaggagaccgtccagccaggttgt
gttggagggcctaagggatcgccgggccagccgggcccccccggccccccaggtgccaaa
ggcctcagagggcttccgggattatcgggaactgatggagcacaagggctcaagggtctc
ccgggagatccaggtccagagggattcccaggacccccaggcttcgtggggcctcgagga
gtcaaaggtgcagtaggccgccctggcctggatggactcccgggtccctccggcctgccg
gggccagtcgggcctccgggagacaggggactccctggagaagtcttgggggcccagccc
gggccccggggagacaccggactgcctggacgctctgggctgaagggcccccccggagaa
agaggccctcctggattccggggaagccaggggatgccaggaataccgggcccgaagggt
cagcagggcttcccaggaccttcgggccagccgggactgcccgggccaccaggacagcat
ggctaccctggagctcctggccgggaagggcccttggggccgccgggcaccccaggtttt
ggaggtctgcctggagacagaggggagccaggtgacacaggtgtccctggccccgtgggc
atgaagggcgtctccggggatagaggtgaccctggctggcagggtgagagaggtcatccc
ggaagccctggattcaaaggagtggccgggatgcctggtgccccgggccccaaaggagtt
aagggttctcccgggatggacggcttccaaggcatgctcgggctcaaggggagatccggg
cttccgggaaacaaaggagagactggattttttggagtccctgggctgaagggcctggct
ggcgagcccggtgtgaaaggcagccgaggggaccccggcccccccggaccacctcccagc
atcctgccaggaatgaaagacatcaaaggagagaaaggagatgaaggccccatgggactg
aaaggatacctgggcttgaaaggccttcccggaatgccagggatccccgggctgtcggga
gtccctgggctgccggggaaaccaggctacgtcaaaggagtcaaaggagataccggattc
cccggcgtgcccgggtcaccaggattccccggcgtgcccggctcccccggaatctcaggg
tttccgggcttcacaggcagtaggggcgacaagggagctccggggagagtaggccttcac
ggcgagatcggccccatcggtgactttggtgatattggaaacactatagaccttccagga
agtccaggcctgaagggggaaggaggcaccgctggagcaccaggtctaaagggattcttc
ggagagaaaggatcagagggtgatgtcggcttccctgggatcaccggcctggcaggagtc
cagggccctcctggacttaaagggcaaacaggctttccaggactgacagggctgcagggg
cctcagggagagtcgggacgggcgggagtgcccggcaccaaaggagactatggctggccg
gggagcccaggcctaccaggtctgcccggcctccgcggtatcggcggcttacacggcttg
ccaggcaccaaaggcttcccaggatccccaggtgcggacatccacggggacgccggctta
ccaggtcctgccggggccaggggtgacccaggagaggccaacacccttccaggccccgca
ggagccccgggacggaaaggggagcgtggagtcccaggggaacgaggcccagttgggagc
ccaggacttcaggggtttccaggcatcacccccccttccaacgtctctgggttaccaggt
gacgtaggcgcgcctgggatatttggcctggaaggttatcgaggtcccccggggccacct
gggcccgtggctcttcctggaatcaaaggagatgaggggagtccaggagcccccggaaac
ccggggaccaaaggatgggtcggggactccgggccccagggccggcctggcgtgttcggg
ctcctgggagaaaaagggcccagaggggagcaaggattcatgggcaacacaggcgccgcc
gggagtgtgggagaccgaggccccaaaggacctaaaggagatcgaggactcccgggtgcc
ccgggtgctgtgggcgccccggggattgcaggaatcccccagagggttgccatccagcgg
ggcccagtgggtccgcagggaaggagaggccctccggggcctcagggggagatgggaccc
cagggccgcccgggagaaccaggtaggagcactgctgcggggccacccctcgtttcctgt
ttgctttgctttcacttttgttcacctgctggaaagcactggctgagcaccagtgatgga
gcatcgcattcttcccggggcactgacacgtgtctcggtggctctgcaggtttccgcggg
actccagggaaggcagggccccagggaagaggcggcgtgtcagctgttcccgggttccga
ggagaccaggggcccgtggggctgcaggggcccgttggctatgaaggggagccaggccgc
cccgggagccccggcctgcctggcatgcccggccgcagtgtcagcatcgggcacctcctg
gtgaagcacagccagacggagcaggaccccatgtgccccgtgggcatgaacaagctctgg
agcggatacagcctgctgtactttgagggccaggagaaggcccacaaccaggatctaggg
ctggcgggctcctgcctggcccggttcagcaccatgcccttcctgtactgcaaccctggc
gatatctgctactatgccagccggaacgacaagtcctactggctctccaccaccgccccg
ctgcccatgatgcctgtggccgaggaggacatcaggccctacattagccgctgctccgtg
tgcgaggccccggccgttgccattgccgtccacagccaggacgtctccatcccccactgc
ccggctggatggcggagcttgtggatcggatattccttcctcatgcacacggccgcgggc
gacgaagggggcggccagtcgctggtgtcaccgggcagctgcctggaggacttccgagcc
acgccgttcatcgagtgcaacggcgcccgaggcacctgccactactatgccaacaagtac
agcttctggctcaccaccatccccgagcagagcttccagggcacgccctcggccgacacc
ctcaaggccggtctcattcgcacgcatatcagccgttgccaggtgtgcgtgaagaacctg
tga

KEGG   Delphinapterus leucas (beluga whale): 111176384
Entry
111176384         CDS       T05885                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04974  Protein digestion and absorption
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111176384 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111176384 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111176384 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111176384 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    111176384 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176384 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111176384 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111176384 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111176384 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111176384 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111176384 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111176384 (COL4A1)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111176384 (COL4A1)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   111176384 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 111176384
NCBI-ProteinID: XP_022432482
UniProt: A0A2Y9NM94
LinkDB
Position
Unknown
AA seq 1668 aa
MGPRLGVWLLLPAALLLHEESSRAAAKGVCAGSGCGKCDCHGVKGQKGERGLPGLQGVIG
FPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPG
IPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHIPGTLLKGERGFPGPP
GAPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPG
VPGQAQVREKGEYAAKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGEKGEKGSL
GFPGDSGYPGLPGREGLKGDKGEAGPPGPPGIVIGTGPLGEKGERGYPGVPGLKGEPGPK
GFPGIQGPPGSPGFPIPGLSGPPGFPGERGEKGDQGLPGVSLPGPGGRDGLPGPPGPPGP
PGQPGHTNGIVECQPGPPGDQGPPGSAGQPGLTGEVGEKGQKGDSCLICDSTGLRGPPGP
QGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGVPGLMGQPGAKGEPGEIYFDIRLKG
DKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDVG
PPGPPGFGPIGPIGDKGQMGFPGNPGSPGLPGPKGEEGKVMPLPGPPGATGLPGSPGFQG
PQGDRGFPGTPGRPGLSGEKGSVGQPGIGFPGPPGPKGVDGLPGDTGPPGNPGRQGFNGL
PGNPGPPGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGNVGGPGVPGEHGAIGPAGLQGIR
GDPGPPGLQGPKGASGVPGIGPPGAMGPPGGQGPPGSSGPPGVKGEKGFPGFPGLDMPGP
KGDKGPQGLPGLTGQSGLPGLPGQQGTPGQPGFPGPKGEMGVMGTPGQPGSPGPAGVPGL
PGEKGDHGFPGSSGPRGDPGFKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGP
TGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGI
PGEKGVPGLPGLQGIPGSPGEKGAKGEKGQAGLPGIGIPGRPGEKGDQGVAGFPGSPGEK
GEKGSSGIPGMPGSPGPKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGIKGEAGLPGKP
GLTGPAGQKGEPGSDGFPGSAGEKGEPGLPGRGFPGFPGAKGEKGSKGDVGFPGLAGSPG
IPGSKGEQGFMGPPGPQGQPGLPGTPGHAVEGRKGDRGPQGQPGLPGLPGPMGPPGLPGL
DGLKGDKGNPGWPGTPGAPGPKGDPGFQGMPGVGGSPGATGAKGDMGPPGVPGFQGQKGL
PGLQGVKGDQGDQGFPGTKGLPGPPGPPGPYDIIKGEPGLPGPEGPAGLKGLQGPPGPKG
QQGVTGSVGLPGPPGIPGFDGAPGQKGEAGPFGPPGPRGFPGPPGPDGLPGSMGPPGTPS
VDHGFLVTRHSQTIDDPQCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMP
FLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGEGIRPFISRCAVCEAPAMVMAVH
SQTIQIPQCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT
CNYYANAYSFWLATIERGQMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5007 nt   +upstreamnt  +downstreamnt
atggggccccggctcggcgtctggctcctgctgcccgccgccctcctgctccacgaggag
agcagccgggccgccgcgaagggtgtgtgtgctggctctggctgtgggaaatgcgactgc
catggcgtaaagggacagaagggagaaagaggtctcccagggttacaaggtgtcatcggg
ttcccgggaatgcaaggacctgaggggccgcagggaccaccaggacagaagggtgacacc
ggagagcccggactgccagggactaaggggacaagaggacccccaggagcatctggttac
cctggaaacccaggacttcctggtattcctggccaagatggtcctccgggtcccccaggt
atcccaggatgcaacgggacgaagggtgagagagggcctctggggcctccgggtttgcct
ggattcgctggaaatcccgggccaccagggttgccgggaatgaagggggatccaggtgaa
atacttggccatataccagggaccttgttgaaaggtgaaagaggatttcctggaccccca
ggagcacctggttcgccaggactgccagggctgcaaggtcctgttggtcccccgggattc
actggaccaccaggtcccccaggccctcctggccctccaggtgaaaaggggcaaatgggc
ttgagttttcaagggccaaaaggtgacaagggtgatcaaggggtcagtgggcccccagga
gtcccaggacaagctcaagttcgagagaaaggagagtatgctgcaaaaggagagaagggc
caaaaaggtgaacctggatttcaggggatgccaggggttggagagaaaggtgaacccgga
aaaccaggaccccgaggaaaaccgggaaaagatggtgaaaaaggagaaaaagggagtctg
gggtttccaggggattcggggtacccaggactcccaggccgagagggtttaaagggagac
aaaggtgaagccggccctcctggcccacctggaattgtgatcggcacaggacccttggga
gagaaaggagagcgggggtacccaggggttccagggttgaaaggggagccaggccccaaa
ggtttcccaggaatacaaggcccgccaggctctccaggcttcccgataccagggctgagc
ggtccccccggcttccccggtgaaagaggagagaaaggcgaccagggcttgccaggcgtg
tccttgcccggaccaggtggaagggatgggctaccgggcccccctgggccccccggcccc
cctgggcagccaggccacacaaatggaattgtggaatgccagcccgggccgccaggtgac
cagggtcctcccggaagtgcggggcagccgggattgacaggcgaagttggagaaaaaggt
caaaaaggagatagttgtctcatctgtgactcaacaggacttcgtgggcccccagggcca
cagggaccccccggagaaataggtttcccaggacagccaggggccaagggcgacagaggt
ttacccggcagggatggtcttgaaggattgcctggaccgcaaggtgtgccagggctgatg
ggccagccaggagccaagggcgagcctggcgagatttacttcgatattcgactcaagggc
gacaaaggagacccaggtttcccaggccagcccgggatgccagggagagcaggctctccc
ggaagagacggccatccgggtctgcccggccccaaaggctccccgggttcagtaggatta
aaaggagaacgtggccccccgggaggagttggattccccggcagccgtggtgacgtcggc
cctcctgggcctccagggtttggccctattggccccattggtgacaaaggacagatgggc
tttccgggaaaccccgggtccccaggcctgccaggtcccaagggtgaagaaggaaaggtc
atgcccttacccggtccccctggagcaacaggacttccggggtcccccgggttccaaggg
ccccaaggtgaccgaggttttcctggaaccccgggaaggccgggtctctctggagagaag
ggttcagtcggccagcctgggattggctttccagggcctcccggccccaaaggtgttgac
ggtttacctggagacactggacctcctggaaatcccggtcgccaaggtttcaatggctta
cctggcaacccaggtccgcctggccaaaagggcgagcctggagttggtctgccgggactc
aaaggtctgccaggactccctggcatccccggcacccctggagagaagggaaatgtcggg
ggaccaggcgttcctggagagcacggcgccatcggccctgcaggccttcagggaatcaga
ggtgacccgggacctcctggattgcaaggccccaaaggagcttctggagtccccggaata
ggccctcctggagctatgggaccccctggaggacagggacccccagggtcatcaggcccc
cctggagtgaaaggagagaagggcttccccggattcccaggcctggacatgccgggcccc
aaaggagacaaagggcctcaggggctccccggcctgacgggacagtcgggactgcctggt
ctccctggacagcagggcacacctggacagcccgggttcccaggtcccaagggagagatg
ggcgtcatggggacccccgggcagcccggctcgccaggaccagcgggtgtgccaggattg
ccgggtgaaaaaggggaccacggcttcccgggcagctcgggacccaggggagaccctggc
ttcaagggtgataaaggagatgtgggtcttcctggcaagccgggctccatggataaagtg
gacatgggcagcatgaaaggccagaagggagaccaaggagaaaaaggacaaatcggccca
actggtgataaaggatcccggggagatcctggaaccccaggagtgcctggaaaggacggt
caggcaggacaccctgggcagccaggacctaaaggtgatccgggcataagtgggacccca
ggtgctccgggacttcctggacccaaaggatcggttggtggaatgggcctgccaggaata
cctggagaaaaaggtgtgcctggcctccctggcctgcagggcatccctggctcacctgga
gaaaagggagcaaaaggagagaaagggcaggcgggtctacctggcattgggattccagga
cggcccggggagaagggagaccaaggggtagcaggttttccaggaagccctggagagaag
ggagagaaaggaagcagtgggatcccagggatgcccgggtctccgggccccaaaggctca
ccagggagtgttggctatccaggaagccctgggttgcctggagaaaaaggtgacaaaggc
cttccgggattggatggcatccctggcatcaaaggagaagcaggtcttcctgggaagcct
ggtctcacgggcccggccggccagaaaggggagcccggcagtgatggattcccagggtcg
gcaggagagaagggtgaaccaggtctacccggaagaggattcccagggtttccaggggcc
aaaggagagaaaggttcaaagggtgacgtgggtttcccaggcttagctgggagcccagga
attcctggatccaaaggagaacaaggattcatgggtcctccggggccacagggacagccg
ggattgccaggcactccgggccacgcggtggaggggcgcaaaggagaccggggcccacag
ggccaacctggcctgccagggcttccgggacccatggggcctccagggctccctgggctt
gatgggctgaaaggtgacaagggaaacccaggctggccgggcactcctggggctccaggg
cccaagggagacccaggattccagggcatgccgggggtcggtggctctccaggagctaca
ggtgctaagggtgatatgggacctccaggagttccagggtttcaagggcagaaaggcctc
cctggccttcagggagttaaaggtgaccaaggagaccaaggtttccctggaactaaaggt
cttcctggtcccccgggccccccgggtccatacgacatcatcaaaggggagccagggctc
cctggtcctgagggccccgcaggtctgaaagggcttcagggacctccaggccccaaagga
caacaaggtgtgacaggatctgtgggcttacctgggccaccaggtattcccgggtttgat
ggggcccctggccagaaaggagaggcaggaccctttggacctcctggtccaagaggcttc
ccgggtccacccggccctgatgggttgccgggatccatgggtcccccgggcaccccgtct
gttgatcacggcttcctcgtgaccaggcacagtcagacaatagacgacccccagtgtcct
cctgggaccaaaatcctctaccatgggtactctctgctctacgtacaaggcaatgagcgg
gcgcacggccaggacttgggcacggcgggcagctgtctgcgcaagttcagcacgatgccc
ttcctcttctgtaacatcaacaacgtctgcaacttcgcctcccgaaatgattactcgtac
tggctgtccaccccggagcctatgcccatgtccatggcgcccatcaccggggaggggatc
aggcccttcatcagcaggtgtgctgtgtgtgaggctccggccatggtcatggctgtgcac
agccaaacgatccagatcccgcagtgccccagcggctggtcctcgctctggattggctac
tcctttgtgatgcacaccagcgccggagcggaaggttctggccaagccctggcctcccct
gggtcctgtctggaagagttcagaagcgcccccttcatcgagtgccacggccgcgggact
tgcaattactatgcaaacgcttacagcttttggcttgccacgatagaaagaggccagatg
ttcaagaagcccacgccgtccaccttgaaggctggagagctgcgcacgcatgtcagtcgc
tgtcaagtgtgcatgcggagaacataa

KEGG   Delphinapterus leucas (beluga whale): 111177115
Entry
111177115         CDS       T05885                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111177115 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111177115 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111177115 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177115 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111177115 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111177115 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111177115 (LAMC3)
   05145 Toxoplasmosis
    111177115 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B XhlA F5_F8_type_C
Other DBs
NCBI-GeneID: 111177115
NCBI-ProteinID: XP_022434146
UniProt: A0A2Y9NMP1
LinkDB
Position
Unknown
AA seq 1577 aa
MAAVAALLLGLALLTPRAAGAGMGACYDDAGRPQRCLPVFENAAFGRLAEASHTCGRPPE
DFCPHVGAQGAGAQCQRCDAADPERHHNASYLTDFHSQDDSTWWQSPSMAFGVQYPTSVN
ITLNLGKAYEITYVRLKFHTSRPESFAIYKRTRAGGPWEPYQYYSASCQTTYGKPEGQYL
RLGEDERMAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQDWVTSTEFLISLD
RLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPNEEGRLVCRCQHNTVGT
DCERCLPFFQDRPWARGTAEAASECLPCNCSGRSEECMFDRELFRSSGHGGRCLHCRDHT
AGPHCERCRENFYRWKPQMPCQPCDCHPAGSLRLQCNDSGTCMCKPTVMGWKCDRCLPGF
HSLSEGGCRPCTCNPAGSLGICDPRSGRCPCKENVEGNLCDRCRPGTFSLQSHSPAGCSS
CFCYGHSRACAAAAHFREHHILSDFRRGAEGWRTRSMGGPEHPAQWSPRGLLLDPEGKEE
LTAPEKFLGDQRFSYGQPLTLTFRSPPRGSPIPVRLRLEGAGLTLTLRHSSAPSPLDARQ
PGEVQLKFLLQETSEDVDPPLPPFHVQRLLTNLTALRIQASGHSASPAGPVFLTEVRLTS
ARRGLSPPASWVETCSCPRGYTGQFCESCALGYKRETPLGGPYASCVPCTCNQHGTCDPN
TGICLCDHHTEGPSCERCLPGFYGNPFTGQADDCQPCPCPGQSACMTIPESREVVCTHCP
RGQRGWRCEICDDGFFGDPLGLSGAPQPCQLCQCSGNVDPNAVGNCDPLSGRCLRCLHNT
TGAHCESCEEGFYGSALSPRPADKCVPCSCDQAGSVGEQRPCDPVTGQCTCLPHVTGRDC
GHCSPGFYDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCPCRPGVEGQACDRCQLGFFGFS
IEGCRACRCSPLGAASAQCHENSTCVCRPGFVGYKCDLCQDNFFLTAGGTHCQECPSCYA
LVKKEAAKLKARLTLMEGWLQGSNCGRPWGPLDILQGEAPRGDVYQGHPLLQGAQEDFLE
QVTGLEGAVKAAQEQLQALSRKAHCAQARAEKTCVQLADLEAVLESSEEEILHAATILAS
LAIPQEGLGQPTSWSRLAIEARALARSHRDTTTRIEATARRALLTSNSSYALLWSLVEGR
TALEAQQELEDRYQEVHAAQRALGTAVAEVLPEAERVLAAVQQVGADAAQRLASPAAPAA
PPQKSQARTLGLKVQALEKTVTSRERVVTEAAQALQATAQAVLHKTEPLTQLHREARAAL
TRASSSVRAAMVTVTGARTLLADLEGMKPRFPRPKDQAALRRQAAIVQDRLLAESKKKTK
QVERMLGNAASISSSAKKKGREAELLAKDSAKLAKALLREGKQEHRRAGRLSSQTQSMLQ
QASQQVLASEARRQQLEATDQVGAGLSEMEKQIRESRTSLEKDIKALSELLARLGSLDTL
GAPARALNETQRALERLRLQLGPPGVLQGKLRLLEQESEQQQLQIQSFESNLAEIRADKQ
NLEAILHSLPDSCASWQ
NT seq 4734 nt   +upstreamnt  +downstreamnt
atggcggcggtggccgcgctcctgctgggtctggcgctcctgacgccgcgggcggccggc
gcgggcatgggcgcgtgttacgacgacgcggggcgcccgcagcgctgcctgcccgtgttc
gagaacgcggcgttcggccggctagccgaggcctcccacacgtgcggccgcccgcccgag
gacttctgtccgcacgtgggcgctcagggagcgggggcgcagtgccagcgctgcgacgcc
gccgaccccgagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgac
agcacctggtggcagagcccgtccatggcctttggggtgcagtaccccacctcggtcaac
atcactctcaacctggggaaagcttacgagatcacctacgtgcggctgaagttccacacc
agccgccctgagagcttcgccatctacaagcgcacccgggccggcggtccctgggagccc
taccagtactacagcgcctcctgccagacgacctacggcaagcccgagggccagtacctg
cgcctcggcgaggacgagcgcatggccttctgcacctccgagttcagcgacatctccccg
ttgagcgggggcaacgtggccttctccaccctggagggccggcccagtgcctacaacttt
gaggagagccccgtgttgcaggactgggtcaccagcaccgagttcctcatctccctagac
cggctcaacacgtttggggatgacatcttcaaggaccccaaggtgctgcagtcctactac
tacgctgtgtccgacttctccgtgggcggcaggtgcaagtgcaacgggcacgccagcgag
tgtggccccaacgaggagggccggctggtctgccgatgccagcacaacaccgtgggcacg
gactgcgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcacagccgag
gcggccagcgagtgtctgccttgcaactgcagcggccgctctgaggagtgcatgtttgac
cgggagctcttccgcagctcgggccatggtgggcgttgcctccactgccgtgaccacaca
gccgggccacactgtgagcgctgccgggagaacttctatcgctggaagccacagatgcca
tgccagccctgtgactgccacccagcaggctccctgcgcctccagtgcaatgactctggc
acctgcatgtgcaagcccacggtgatgggctggaagtgtgaccgctgcctgcccgggttc
cactcgctcagtgagggcggctgcagaccctgtacctgcaatcccgctggcagcctgggc
atctgtgatccccgcagtggccgctgtccctgcaaagagaatgtggaaggcaacctgtgt
gacaggtgtcgcccgggcacatttagcctgcagtcccacagcccagccggctgcagcagc
tgtttctgctacggccactccagggcgtgcgcggccgctgcccacttccgggagcaccac
atcctctccgacttccgccggggagccgagggctggcggaccagaagcatggggggccca
gagcatcctgcacagtggagcccgagagggcttctcctggacccagagggcaaggaggag
ctcacagcaccagagaagttcctgggagaccagcggttcagctatgggcagcccctcaca
ctgacattccggagcccccccaggggctcccccatccctgtgaggctgaggctggaaggg
gcgggtctgaccttgactctgcggcattccagcgcgcccagccccctggacgccaggcag
ccgggggaggtacagctcaagttcctgttgcaagagacctctgaggacgtggaccctccg
ttgccgcccttccacgtccagcggctgctcaccaatctgactgctctgcgcatccaggcc
agtggccacagtgccagccctgccggcccagtgttcctgactgaggtccggctcacgtcg
gcccggcggggactctccccgccagcctcctgggtggagacttgctcgtgtcccaggggc
tacacgggccagttctgtgagtcctgtgctctgggatacaagagggagacaccactgggg
ggtccctatgccagctgtgttccctgcacctgtaaccagcatggcacctgtgaccccaac
acagggatctgcctatgcgaccaccacaccgagggcccgtcctgtgagcgctgcttgcca
ggtttctacggcaaccccttcacaggccaagccgatgactgccagccctgtccgtgccct
ggacagtcggcctgcatgaccatcccagagagcagagaggtggtgtgtacccactgcccc
cggggccagagagggtggcgctgtgagatctgtgatgatggcttttttggggacccgctg
gggctctctggggccccccagccttgccagctgtgtcagtgcagtgggaacgtggacccc
aacgcagtgggcaactgtgaccccctgtctggccgctgcctgcgatgcctacacaacacg
acaggtgcccactgtgagagctgtgaggaaggcttctacgggagcgccctgtcccctcgg
cccgcagacaaatgcgtgccctgcagctgcgaccaggcgggctcagtcggcgagcagaga
ccctgtgacccagtgaccggccagtgcacctgcctgcctcatgtgaccggacgggactgt
ggccactgcagccctggcttctacgacctccagcctggcaggggctgccggagctgcaag
tgccacccgctgggctcccaggaggaccagtgccaccccaagaccgggcagtgcccctgc
cgtccaggcgtcgagggccaggcctgcgacagatgccagctgggtttcttcggcttctcc
atcgagggctgccgggcctgcaggtgctccccgctgggcgccgcctcggcccagtgtcac
gagaacagcacgtgtgtgtgcaggcccggctttgtgggctacaagtgtgacctctgccag
gacaacttcttcctcacggccggcggcacacactgccaggagtgcccgtcctgctacgcc
ctggtgaagaaggaggctgccaagctaaaggccagactgaccctgatggaagggtggctg
caggggtcaaactgtggcaggccctggggaccactggacattctacagggagaggcccca
cggggggacgtctaccagggccaccccctgctgcaaggggcccaggaagacttcctggag
caggtgacaggccttgagggtgctgtgaaggctgcccaggagcagctgcaggcactgagc
aggaaagcccactgtgcccaggccagagctgagaagacctgcgtccagctggcagaccta
gaggcggtgctggagtcctcagaagaggagattctgcatgcagccaccatccttgcatct
ctggcgattcctcaggaagggctcggccagcccaccagctggagccgtctggccatagag
gcccgtgccctcgccaggagtcacagggacaccaccaccaggattgaggccactgctcgg
agggccctgctcacctccaacagcagttatgcgcttctctggagtctggtggaggggaga
acagccctggaggcccagcaggagctagaggacaggtaccaggaggtacatgcggcccag
agggcgctgggcacggctgtggcagaggtgctgcctgaagctgagagggtgctggccgcc
gtgcagcaagtcggcgcagatgcagcccagcgcctggcctcaccggctgcccctgcagca
ccgcctcagaagtcccaggccaggaccctgggcctgaaggtgcaggccctggagaagacg
gtcacatcgagagagcgcgtggtcaccgaggctgcccaggccctccaggccaccgcccag
gccgtgctgcacaagacagaaccccttacgcagctgcaccgggaagccagagctgctctg
acccgggcttcctcatctgtccgggctgccatggtgactgtcacaggagccaggactctg
ctggctgacctagaaggaatgaagccaaggtttcctcggcccaaggaccaggccgcactg
aggaggcaggcagccatcgtccaggacaggctccttgcagagtccaaaaagaagaccaag
caggtggagaggatgctgggaaatgcggcatctatctcctccagtgccaagaagaagggc
agggaagccgagctgttggccaaggacagtgccaagctcgccaaggccttgctgagggag
gggaagcaagagcaccgccgggctggccggctctccagccagacgcagtcgatgctccaa
caggcctcccagcaggtgctggcctcagaagcacgcagacagcagctagaagcaactgat
caggtgggtgccgggctgagcgagatggagaagcagatccgggaatcacgcacctctctg
gagaaggacatcaaagccttgtcggagctgcttgccaggctggggtcactggacaccctc
ggagcccccgcccgggccctgaatgagacccagcgggcactggagcgcctgaggctgcaa
ctgggcccaccaggggtgctgcaagggaaactgaggctcttggagcaggagtctgaacag
cagcagctgcagatccagagcttcgagagcaaccttgctgagatccgtgctgacaagcag
aatctggaggccattttgcatagcctgccagacagctgtgccagctggcagtga

KEGG   Delphinapterus leucas (beluga whale): 111181472
Entry
111181472         CDS       T05885                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha-3 isoform X1
  KO
K06240  laminin, alpha 3/5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111181472 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111181472 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111181472 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181472 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111181472 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111181472 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111181472 (LAMA3)
   05145 Toxoplasmosis
    111181472 (LAMA3)
SSDB
Motif
Pfam: Laminin_I Laminin_G_2 Laminin_G_1 Laminin_EGF Laminin_II Laminin_B Laminin_G_3 COG5 DUF885
Other DBs
NCBI-GeneID: 111181472
NCBI-ProteinID: XP_022442542
UniProt: A0A2Y9PH11
LinkDB
Position
Unknown
AA seq 2738 aa
MLESDCRIAGVSFSQSRNCPFCNLGARMLSYLPRMPMPRGGNRERNWRVWADGDCHCKSH
VGGDSCDTCEDGYFALEKSSYFGCQGCQCDIGGAVTPVCSGPSGVCRCREHIVGKTCQRP
ENNYYFPDLHHMRYEIEDGTTPNGRALRFGFDPLEFPEFSWRGYAQMTSIQNEVRIVLNV
GKSSLSLFWVVLRYINPGAEAVSGRVTIYPSWAKADAAQSKETIFQPSKEPAFVTVPGNG
FADPFSIVPGAWIACIKAEGVLLDYLVLLPRDYYEALSLQLLVTEPCADVGPPRENCLLY
QHLPVTRFPCALASEARHFLLDGEPRPLAVRQPIPEHPVMADLSGREVELHLRLRVPRVG
HYVVVVEYATEADQLSEADVLVQGPGADLAGRVNIYSCKYSVLCRSAVTDGRSRLAVYEL
LEDADVWLKARMARFLLHQICIIPTEEFSVEYLRPHVKCIASYGRFVNESATCISLVPET
PPTALILDVPNGGSSPLLPQDPLPSADALTGVTLKAPQNQVTLRGLVPRPGRYVIVVHFY
QPVHPTFLAQVSVDRGRLQPGIFRASFCPHVLGCRDQVIAGDQVEFDISEPEVAVTVKVP
EGKSLVWVRVLVVPAENYDYQILHRKSVDKSFEFVTNCGGDSFYIDPQKASGFCKDSARS
LVALYHDGALPCECHPAGAIGHRCSPEGGQCPCRPHVIGRQCTRCQMGYYGFPHCKPCTC
GRRLCEETMGMCLCPPRTVRPQCDACETHSFSFHPLAGCEGCNCSRMGTDGAATPECDRD
HGQCRCKPRITGRQCDRCASGFYRFPECLPCQCNRDGTEPAGCDPGTGSCLCKENVEGTE
CNVCQEGSFYLDPANPKGCTSCFCFGVSHRCHSSRKRRAKFVDMMGWRLETADGVDIPIS
FNPGSSSVVADLQELPSTVHSASWVAPASYLGDKVSSYGGYLTYQMKSFGLPGDMVLLEK
KPDVQLTGQHMSVIYEGPNDPRPDRLHHGRVQVVEGNFRHASSGAPVTREELMMVLSRLQ
GVHLRGLYFTETQRLTLSGVGLEEASETGSGRQAHNVEMCACPPDYTGDSCQGCSPGYYR
DNKGLYTGRCVPCNCNGHSHRCQDGSGICMNCHHNTAGEHCERCKEGYYGNAVHGSCRVC
PCPHSNSFATGCVVTGGNVKCFCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGH
LGSCDPLTGDCINQEPKDGGPGEECDDCDSCVMTLLNDLATMEDELLLVKSQLQGLSVSV
GTLEQMRHLETQTKDLRSQLLSYSSTISNHKSKLDGLEKELSNLNREFETLQEKVQINSR
KAQTLYSNVDRTTQGAKELDTKIKNVIRNVHVLVKQISGTEGEGNNLPLDDFSRKLAEAE
RMLRELRNRNFGKNLREAEAEKREAQLLLTRIRSWLENHQVENNGLVKNIRDSLNEYEAK
LSDLRAALQEASAQAKQATSLNRENERALESIKRQVKEMNSLQSDFSKHLATADSSLLQS
NVALELMSKSLEEYEKLAVTLNEARHELSDKVRELSKSSSKASLVGEAEKHARSLQELAR
QLEEIKRNTSGDELVRCAVDAATAYENILNAIKAAEDAADKATSASEAALQTVIKEDVPR
KAKTLSSNSDKLLNEAKITQKKLQQEISPALNNLQQTLKIMTVQKGLVDTNLTTIRDDLR
GIQRDDIDGIINSAKSMVRNANDITNDVLDGLNPIQIDVERIKDTYGSTGSEDFNKALTD
ADNSVKKLTNKLPDLLSKIESINQQLLPLGNISDNMDRIRELIQQARDAANKVAIPMRFN
GKSGVEVRLPNDLEDLKGYTSLSLFLQRPESTESGGTENMFVMYLGNKDASRDYIGMAVV
DGQLTSVYNLGEREAELQVGQTLTRSETQEAVMDRVKFQRIYQFARLNYTRKATSSKPET
PQFHDMDSGDSNTLLDLDPENVVFYVGGYPSDFRLPSRLRFPPYKGCIELDDLNENVLSL
YNFKKTFNLNTTKVEPCRRRKEESDKNYFEGTGYARVPTQPNAPFPTFGQTIQTTVDRGL
LFFAENQDHFISLNIEDGSLMVRYKLNSEQPKEKGIRGIINDGKDHLILIKIGKAQNLMR
INVDSQSIKIEGDILDFSTYYLGGIPISIRERFNISTPAFRGCVKNLKKTTGVVRLNDTV
GVTKKCSEDWKLVRSASFSRGGQLSFTNLDFPSPSHFQASFGFQTFQPSGILLNHQTGAS
SLQVTLEDGHIELSTRDSSSPIFTSPQTYMDGLLHYVSVISDNSGLRLLIDDQSLKNNQR
LLGFSNSQQSLRLGGSYFEGCISNVFVQRLSESPEVLDLASKSTKRDVSLGGCSLNESPF
LMLLNGSTRFNKAKTFNIHQPWCDTPAASPRSLKVRGDSQSCPPLPEAQASHGALRFGDS
PTSHLLFMLPQELLKPRSQFAVDLQTTASRGLVFYTGTKNSFMALYLSKGRLVFALGAGG
KQLKLKSKEKCSDGKWHTVAFGQDGERGRLVVDGLRAQEGSLPGNSTVSLRAPVYLGSSP
SGKPKTLPQNSFVGCLRNFQMDLKPLDTASASFGVSPCLEKGIYFSQEGGHVILANSVLL
GPKFKLVFSIRPRSLTGILIHIGRQPGEHLSVYMEAGKVTASVGSEAGGILTSVTPKQSL
CDGQWHSVTVTIKQHILHLKLDADHSSTAGRHPVPTARTQEHLHIGGVPANLKTLKLPVW
RSFFGCLKNIQVNHIPVPVTEAAEVRGTVSLNGHCPDH
NT seq 8217 nt   +upstreamnt  +downstreamnt
atgctagaaagcgattgtaggattgctggtgtgtccttttcccagagccggaactgtcct
ttttgtaaccttggtgcaaggatgctctcttatcttcccagaatgccaatgccacgtggc
gggaaccgtgagcggaattggagagtgtgggcagatggtgactgtcactgtaagtcccac
gtcggtggtgattcctgtgacacgtgcgaagatggatattttgctttggaaaagagcagt
tactttgggtgtcaagggtgtcagtgtgacattggtggagccgtcacccctgtgtgcagc
gggccctctggagtctgccggtgccgagagcacatcgtggggaagacctgccagcgacct
gaaaacaactactatttcccggatttgcatcatatgaggtatgagattgaagatggcact
acacccaacggaagagcgcttcggtttggatttgatcccctggagtttcctgagttcagc
tggagagggtatgctcagatgacctcgatacagaatgaagtaaggatcgtgttgaatgtg
gggaagtcaagtctctccttgttttgggttgttctgagatatattaaccctggagctgaa
gcagtatctggccgtgtaactatttatccatcctgggctaaggcagatgctgctcaaagc
aaagagaccatcttccagccgagtaaggagccggcctttgtcaccgtacccggaaatggt
tttgcagatccattttcaattgtaccaggagcatggatcgcttgtattaaggcggaagga
gtcctcctggactacctggtactgctccccagggactactatgaagctctctcgctgcag
ctgctggtcacagagccgtgcgccgatgtaggcccgccccgagagaattgcttgctttac
cagcacttgccagtgacccgattcccctgtgccctggcttctgaggccagacacttcctg
cttgacggggagccaagacccttggcagtgaggcagcccatccctgaacacccagtcatg
gcggacctcagtgggagagaggtggagctgcacctgcggctgcgggtcccgagggtcggc
cactacgtggtcgtggtcgagtatgccacggaagcagaccagctgtctgaggccgacgtg
ctcgtgcagggccccggggctgacctggcaggccgggtgaacatctacagctgcaaatac
agcgtcctctgccggagcgctgtgaccgacggcaggagtcgccttgctgtgtacgagctg
ttagaagatgcagatgtttggctcaaagcacggatggcccgattccttctgcatcaaatt
tgtatcatacccactgaagaattctcagtggaatatttgagacctcacgtcaaatgcatt
gccagttatgggagatttgttaatgaaagtgccacctgtatctccttggtccctgaaact
cctccaacagcattaattttggatgttccgaatggtgggtcttcccctctcctgccccag
gaccctttaccttctgctgacgctcttactggagtcaccttgaaggccccacagaaccaa
gtgaccttgcgaggactcgtaccgcgtccgggtcgatacgtcattgtggtccatttttat
caaccagtgcatccgacgttcctggcacaggtgtctgtggacagagggcggctgcagcca
ggcatcttccgtgcctctttttgcccccatgtgcttggctgccgggaccaagtgatcgcc
ggagatcaggttgagtttgacatctcggagccggaggtggccgtgactgtgaaggttcca
gaaggaaagtccttagtttgggtccgtgtcctagtggtgcctgcggagaattacgactac
caaatccttcacagaaaatcagtggacaagtcattcgagtttgtcaccaattgtggaggg
gacagtttttatattgacccccagaaagcctctggattctgtaaggattctgccaggtcc
ctggtggccctttaccatgatggtgcactgccttgtgagtgccaccccgccggggccatt
ggccatcgctgcagcccagagggcgggcagtgcccatgccggccccatgtcattgggcgg
cagtgtacccgctgtcaaatgggctactacggattcccgcactgcaagccgtgcacctgc
ggccggcgcctttgtgaggagacgatggggatgtgcctttgcccgccccgcacagtcagg
ccccagtgtgatgcgtgtgagacacattccttcagcttccacccgctggccggctgcgaa
ggctgcaactgttccaggatgggcaccgacggggctgccaccccggagtgcgacagggac
catggacagtgcagatgcaagcccagaatcacagggcggcagtgtgaccggtgtgcttcc
ggcttctaccgcttccctgagtgcctcccctgccaatgcaacagagatgggactgagcca
gcaggctgtgacccggggacagggtcttgtctctgcaaggaaaatgtggaaggtacagaa
tgtaacgtgtgtcaggaagggtcattctacctggacccagcgaaccccaaaggttgtacc
agctgcttttgtttcggtgtcagtcatcgttgtcacagctcacgtaagaggagagctaag
tttgtggatatgatgggctggcgcctggagacggcggacggagtggacatccccatctcc
ttcaacccgggcagcagcagcgtggtggccgacctccaggagctgccctcaacggttcac
agcgcgtcgtgggtcgcccctgcttcctacctgggggacaaggtttcctcatatggtggc
tacctcacctaccaaatgaagtcctttggactgcctggtgacatggttcttctggaaaag
aagccagatgtgcagctcaccggtcagcacatgtccgtcatctatgaggggccgaatgac
ccccggccagaccggctgcatcatggacgagtgcaggtggtagagggaaacttcagacac
gccagcagcggtgcccccgtgactcgggaagagttgatgatggtgctgtctagactgcaa
ggtgtgcatctccggggcctctacttcaccgagacacagcggctcaccctgagcggggtg
gggctggaggaggcctcggaaacaggaagtggacgtcaagcacataatgtagagatgtgt
gcctgcccccctgactacacaggtgactcatgtcagggttgtagccctggatactatcgg
gataacaaaggcttatataccggacggtgtgttccctgcaattgcaacggacattcacat
cgctgccaggatggctcgggaatatgcatgaactgccatcataacactgccggggaacac
tgtgagcgctgcaaagagggttactatgggaacgctgtccacggatcctgtagggtctgc
ccgtgtcctcattcaaacagttttgccaccggctgtgttgtgactgggggaaacgtgaag
tgcttctgcaaagctggatacacaggaacacaatgcgaaaggtgtgcaccaggatatttt
ggaaatccccagaaatttggaggcagctgccaaccatgcagctgtaacagcaacggccat
ttgggcagttgtgaccccctgacgggagactgcataaaccaggaacccaaagatggtggc
cctggagaagaatgtgacgattgtgacagctgtgtgatgacgctcttgaacgacctggcc
accatggaggacgagctcctcctggtcaagtctcagctgcagggcctgagtgtcagcgtg
gggaccctggagcagatgaggcacttggagacccagaccaaggacctgaggagccagttg
ctcagctacagttccaccatttcaaatcataaatcaaaactggatggcctggaaaaagaa
ctgagtaacttgaatcgtgaatttgaaactttgcaagaaaaggttcaaataaattccaga
aaagctcaaacattatatagcaatgttgatcggacaacccaaggcgccaaagagctggac
acaaagattaaaaatgtcatccggaatgtgcacgttcttgtgaagcagatctctgggaca
gaaggagaaggaaacaacttgcctttggacgatttttccagaaagctggctgaagcggag
cgcatgttgagggaactgaggaaccgcaactttgggaagaacctgagggaagcagaagct
gaaaaaagagaggctcagcttctgctgactcggataaggagctggctggaaaaccaccag
gtggagaacaatgggcttgtgaagaatatacgagattctttaaatgaatacgaagccaaa
ctcagtgacctccgtgccgctctacaggaggccagtgcccaagcaaagcaggccaccagc
ctcaaccgagagaacgagagggctttggaatccatcaagagacaagttaaagaaatgaat
tccctccagagtgacttcagcaagcatctagccactgcagactcttccttactgcaaagt
aacgttgccttggagctgatgagtaaaagcctcgaggaatatgaaaaactagctgtcact
ttaaatgaagcaagacacgaactaagtgacaaagtgagagaactttccaaatcgtccagt
aaagcatccctggtgggggaggcagagaagcatgcgcggtctttacaggagctggcaagg
cagctggaggagatcaagaggaacaccagtggggatgagctggtacgctgtgccgtggac
gctgccaccgcctatgagaacatcctcaatgccatcaaagcagccgaggacgcagcggac
aaggccaccagcgcgtctgaggctgccctccagacagtgataaaggaagatgttccaaga
aaagctaaaaccctgagttccaacagcgataaactgttaaatgaagccaagataacccag
aagaagctacagcaagaaatcagtccggctctcaacaacctgcagcaaactctgaaaatt
atgaccgttcagaaagggctggtagacaccaatctcacgaccatccgcgatgatcttcgt
gggatacagagagatgacatcgatggtataatcaatagtgcaaagagcatggtcagaaat
gccaacgacatcacaaatgatgttctagatgggctcaaccccattcagatagacgtggaa
agaattaaggatacctatgggagcaccgggagtgaagacttcaacaaggctctcaccgat
gcagataattcagtaaagaaattaaccaacaaactgcctgatcttttgagcaagattgaa
agtatcaaccaacagctgttgccactgggcaacatctctgacaacatggaccgcatacgg
gagctaattcagcaggccagagatgctgcgaataaggtcgccatccccatgaggttcaac
ggtaaatctggagtggaagtgcggctgccaaatgacctggaggatttgaaaggatacaca
tctctttctttgtttctccaaagacctgaatcaacagaaagtggggggaccgagaatatg
tttgtgatgtacctcggaaataaagatgcctccagggactacataggcatggcagtcgta
gatggccagctcacgagtgtctacaacctgggagaacgcgaggctgaactccaagtgggc
cagaccttgaccaggagcgaaactcaggaggcagttatggaccgggtgaaattccagaga
atttatcagtttgcaaggcttaattacacccgaaaagccacatccagtaagccagaaaca
cctcaattccatgacatggatagtggggatagcaacacgctcctcgatttggaccctgaa
aatgttgtattttatgttggaggttacccatctgattttagacttcctagtagactgaga
ttccctccatacaaaggttgtattgaattagatgacctcaatgaaaatgttctgagcttg
tacaacttcaaaaagactttcaatctcaacacgacaaaagtggagccttgtagaaggaga
aaggaagaatcagacaaaaattattttgaaggtacaggctatgctcgagttccaactcaa
ccaaatgctcccttcccaacctttggacagacaattcagaccaccgtggatagaggtttg
ctgttctttgcagaaaaccaggaccacttcatatctctaaatatagaagatggcagtctc
atggtgcgatacaaactgaattcagagcaaccaaaagaaaaaggaattagaggcatcata
aacgacgggaaagatcatttgattctgatcaaaattggaaaagcccaaaaccttatgcgg
ataaatgtggactctcaaagcattaaaattgaaggtgatatacttgatttcagcacatat
tatctgggaggaattccaatttcaatcagggaaaggtttaacatttctacacctgctttc
cgaggctgcgtgaaaaacctgaagaagaccactggtgtcgttagactgaatgatactgtg
ggcgtaacaaaaaagtgctcggaagactggaagctcgtgcgatctgcctcattctccagg
ggagggcagttgagcttcaccaatttggacttcccgtcgcccagccacttccaggcctcc
tttgggtttcagacctttcaacccagtggcatcttattaaatcatcagacaggggcaagc
agcctacaggtcaccctggaagatggccacattgaactgagcaccagggacagcagcagc
ccaattttcacatctccacagacgtacatggatggtttactgcattacgtgtccgtaata
agcgacaactctgggctccggctcctcattgatgaccagtctctgaaaaataaccaaagg
ctgctaggcttttcaaattcccagcaatccctgcgtctgggcgggagttattttgagggc
tgcatcagcaacgttttcgtccagagattatcagagagtcccgaagtcctagatttggcc
agtaaatccaccaagagagatgtgtccctgggaggctgcagtttaaacgaatcacctttt
ctaatgttgcttaacgggtctacaaggtttaacaaagccaagactttcaatatccaccag
ccatggtgtgacacgccagccgcctccccaaggagcttgaaggtgaggggagattcccag
tcttgcccaccacttccagaggcccaggccagccacggagccctcaggtttggggacagt
cccaccagccacttgctattcatgcttccccaggagttgctgaaacccaggtcacagttt
gccgtggacttgcagacaacggcgtccagagggctcgtgttttacacaggcactaagaac
tcctttatggctctttatctttcgaaaggacgcctggtctttgcactgggggcaggaggg
aaacaactgaagctcaaaagcaaagagaagtgcagtgacgggaagtggcacacggtggca
tttgggcaagatggagaaagggggcgcttggttgtggatggtctgagggcccaggaggga
agtttgcctggaaattccactgtcagcctcagagcaccagtttacctgggatcgtctcct
tcagggaaaccaaagaccctcccccaaaacagttttgtgggatgcctgaggaactttcag
atggatttgaaacccctggacaccgcttctgcaagctttggggtgtctccctgcttggag
aaaggcatctatttttctcaagaaggaggtcatgtcatcctagccaactccgtgcttttg
gggccaaaatttaagcttgttttcagcattcgcccgagaagtctcactggaattctaatt
cacatcggaaggcaacccggggagcacttatctgtttatatggaggcaggaaaggtcacg
gcctctgtgggcagcgaggcaggtgggatcctgacatcggtcacaccaaagcaatctctg
tgtgatggacagtggcactcggtgacagtcaccataaaacagcacatcctgcacctgaaa
ctggacgcagaccatagttccaccgctggacggcaccccgtccccactgcccgcacgcag
gagcatctgcacattggaggtgtcccagctaatttaaaaaccctgaagcttcccgtgtgg
agatccttttttggctgcctgaagaatattcaagtcaaccacattcctgtccctgtcacc
gaagctgcagaagttcgggggactgtcagtctgaatggccactgtcctgaccactaa

KEGG   Delphinapterus leucas (beluga whale): 111184472
Entry
111184472         CDS       T05885                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111184472 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111184472 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184472 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184472 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184472 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184472 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111184472 (LAMB1)
   05145 Toxoplasmosis
    111184472 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Other DBs
NCBI-GeneID: 111184472
NCBI-ProteinID: XP_022448711
UniProt: A0A2Y9PU24
LinkDB
Position
Unknown
AA seq 1786 aa
MGRLQMFAFSFLALCGAQVSAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLYK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTG
PMKKVDDVICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVIRGNCFCYGHASECAPVDGFHAEGEGMVHGHCMC
RHNTKGLNCEQCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVSGG
VCDECQHNTMGRNCEQCKPFYYQHPERDIRDPNLCEQCTCDPAGSQNKGVCDSYTDFSAG
LIAGQCRCKLHVEGEHCDICKEGFYGLSTEDPFGCKSCTCSPLGTIPGRNPCDSETGYCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCSAESGQCVCQPHMIGRQC
NGVESGYYFPTLDHYIYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPPSSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCLEKGVNYTVRLELPQYTSSDSNVDSPYTLIDSLVLMPFCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRRCDRCAPGTFGFGPSGCKPCECHLQGSVNAFCDPITGQC
HCFQGVYTRQCDRCLPGYWGFPSCQPCQCNGHADDCDSVTGECLSCQDYTTGHNCERCSA
GYYGDAIIGSGDHCRPCPCPDGPDSGRQFASSCYQDPVTLQLACVCNPGYIGSRCDDCAS
GFFGNPSDVGGTCQPCRCHHNIDTTDPEACDKETGRCLKCLYHTEGEHCQLCRFGYYGDA
LQQDCRKCVCNYLGTVQERCNGSDCQCDKITGQCLCLPNVMGQNCDRCAPNTWQLASGTG
CDPCNCDAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPSVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCMPCHQCFALWDVIIAELTNRTRKF
LEKAKALKISGVIGPYRETVDSVEKKVNEIRDILAQSPAAEPLKNIGNLFEEAEKLTKDV
TEKMAQVEINLSDTATQNNSTARELDALQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTDSSGPVEQSARTRDRVEDLMLERESQFREKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGQKQCGGPGCGGLVAVAHGA
WQKAMDFDRDVLSALAEVERLSKTVSEAKLRADEAKQNAQAVLLKTNATKEKVDKSNEDL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQQSAADIARAEMLLEEAQRASNSATDVKVTADMVKEALEEAEKAQIAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLLNASQRLSELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSAEDVKKTLDGELDEKYKKVENIIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLL
KDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atggggcggctccagatgttcgcattcagtttcttagccctgtgcggagcccaagtgagt
gctcaagaacccgagttcagctacggctgcgcggagggcagctgctacccggccaccggc
gaccttctcatcggccgagcccagaagctctccgtgacctcgacctgtgggctgtacaaa
cccgagccttactgtatcgtcagccacctccaggaggacaaaaaatgcttcatatgcaat
tcacaagatccttatcatgaaaccctgaaccctgacagtcatctcattgaaaatgtggtc
acgacatttgctccaaaccgtcttaagatctggtggcaatccgaaaatggcgtggaaaat
gtaaccatccaactggatttggaagcagaattccatttcactcatctcatcatgaccttc
aagacgttccgtccagccgctatgctgatagaacgatcgtccgactttggaaaaacctgg
ggtgtatacagatactttgcctatgattgtgagagctcatttcccggcatttccaccggt
cccatgaaaaaagtcgatgatgtaatttgtgattcccgatattctgacattgaaccctca
acggaaggagaggtgatttttcgtgctttagatcctgctttcagaatagaagatccttac
agtccaaggatacagaatctcttaaaaatcaccaacttgagaatcaagtttgtgaaacta
catactttgggagataaccttttggattccagaatggaaatcagagaaaagtactattac
gcggtttacgatatggtgattcgaggaaactgcttctgctatggccacgccagcgagtgt
gccccggtggatggattccatgcagaaggagaaggaatggttcacggacactgcatgtgc
aggcataacaccaagggcctaaactgtgaacagtgcatggatttctaccatgatttacct
tggagacccgccgaaggtcgaaacagcaatgcctgtaaaaaatgtaactgcaacgaacat
tccagctcttgccacttcgacatggcggtctacttggccactggcaacgtcagcggaggg
gtgtgtgatgagtgtcagcacaacacgatggggcgcaactgtgagcagtgcaaaccgttt
tactaccagcacccggagagagacatccgggatcctaatctctgtgaacaatgtacctgt
gacccagctggttctcagaacaagggagtctgtgacagttacacggatttttctgccggt
ctcattgctggtcagtgtcggtgtaaattacacgtggaaggagaacattgtgatatctgc
aaagaaggcttctatggtttaagcactgaagatccatttggttgtaaatcttgtacttgc
agtcctctgggaacgattcctggcaggaatccttgtgattctgagactggttactgctac
tgtaagcgtctggtgacaggacagcattgtgaccagtgtctgccagagcactggggctta
agcaacgacttggatggatgtcgaccttgtgactgtgaccttgggggagccttaaacaat
agttgctctgcagagtcaggccagtgcgtctgccaaccccacatgatcggacgccagtgc
aacggagtggaatctggttactacttccccaccttggatcactacatctacgaagcagaa
gaagccaacttggggcctggggtcagcatagtggagcggcagtatatccaggaccgtatt
ccttcctggactggagcaggcttcgtccgagtgcctgaaggggcttatttggagttcttc
atcgacaacataccatattctatggagtatgacatcctaattcgctatgagccacagctc
cccgaccactgggagaaagctgtcatcacagtgcagcgacctgggaagattccacccagc
agccgatgtggaaacactgttcctgatgatgacaaccaggtggtgtccctatcgcctggc
tccaggtatgtggtcctcccccgccccgtgtgcttggagaagggtgtgaactacacagtg
aggttagagctgccccagtacacctcctcggacagcaatgtggacagcccctacacgctg
atcgattctcttgttctcatgccattctgtaagtcgctggacatcttcactgtgggaggc
tcaggagatggggtcgtcaccaacagtgcctgggaaacctttcagagataccgatgtctg
gagaacagcagaagcgtcgtgaagactccgatgaccgatgtttgcagaaacatcatcttt
agcatttccgccctgttacaccagacaggcctggcttgtgagtgtgaccctcagggctcc
ttaagttccgtctgcgaccccaacggaggccagtgtcagtgccggccaaacgtggttgga
agaaggtgtgacagatgtgcgcccggcacctttggctttggccccagcgggtgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgctttctgtgaccccatcactggccagtgc
cactgtttccagggggtgtacacgcggcagtgtgaccggtgcttacccgggtactggggc
tttccaagttgccagccctgccagtgcaacggccatgcagatgactgcgactccgtgaca
ggggaatgcctgagctgccaggactacaccacggggcataactgtgaaaggtgctcggct
ggttactatggagacgccatcattgggtcaggagatcactgccgtccttgtccttgtcca
gatggtcccgacagcggacgccagtttgccagtagctgttatcaagaccctgttacttta
cagcttgcctgtgtctgtaatcctggatacatcggctccagatgcgacgactgtgcctcg
ggcttctttggcaacccctcggacgtggggggcacgtgtcagccttgccggtgtcaccac
aacatcgacacgacggacccagaagcctgtgacaaggagaccgggaggtgcctcaagtgc
ctgtaccacacggagggcgagcactgccagctctgccgcttcggttactatggcgacgcc
ctccagcaggattgtcgcaagtgtgtctgcaattacctgggcaccgtgcaggagcgctgt
aacggctctgactgccagtgcgacaaaatcaccgggcagtgcttgtgtctccctaatgtg
atgggccagaactgtgaccgctgtgcacccaacacctggcagctggccagcgggacaggg
tgtgacccgtgcaactgcgacgctgctcattcctttgggccgtcttgtaacgagttcacg
gggcagtgccagtgcatgcctggcttcggaggccgcacgtgcagcgagtgccaggagctt
ttctggggggaccccagcgtggagtgccgagcctgtgactgcgaccccaggggcatcgag
acgccgcagtgtgaccagtccaccggccagtgtgtctgcgtcgagggtgtggagggtcca
cgctgtgacaagtgcactcgggggtactcgggcgtcttccccgactgcatgccctgccac
cagtgctttgccctttgggacgtgatcatcgccgagctgaccaacaggacccggaagttc
ctggagaaagccaaggccttgaagatcagtggcgtgattgggccttaccgggagaccgtg
gactcggtggagaagaaagtcaacgagatcagagacatcctggcccagagcccagccgcc
gagccgctgaagaacatcgggaacctctttgaggaagcagagaaactaaccaaagatgtt
acagaaaagatggctcaagtagaaataaatttatccgacacagctacgcaaaacaacagc
acggccagagaactagacgctctacagacagaagcagaaagcctggataacacagtgaag
gagcttgctgaacaactggaatttatcaaaaattcagatattcggggcgccttggacagc
atcaccaagtatttccagatgtctctcgaggcagaggagcgtgtgaacgcctccaccaca
gattccagtggccccgtggagcagtcggcccgcactcgggacagagtggaagacttgatg
ttggagcgagagtcccagttcagggaaaaacaggaggagcaggcccgccttctggatgaa
ctggcaggcaaactacaaagtcttgacctttcagctgctgccgaaatgacgtgtggaaca
cctccgggagcttcctgttccgagaccgaatgtggcggcccaaactgcagaaccgacgaa
ggacagaagcagtgtggggggcccggctgtggcgggctggtcgctgtcgcacacggcgcc
tggcagaaagccatggactttgaccgagatgtcctgagtgccctggctgaggtggaacgg
ctctccaagacggtctctgaagcaaaactgagggcagatgaggcaaaacagaatgctcaa
gctgttctgttgaaaaccaatgctaccaaagaaaaagtggacaagagcaatgaggatctg
agaaatctgatcaagcaaatcaggaactttttgacccaggatagtgctgacctggacagc
attgaagcagttgctaacgaagtactgaaaatggaaatgcctagcaccccacagcagtta
cagaacttgacagaagatattcgtgaacgagttgaaagcctttctcaagtagaggttatt
ctacagcagagtgctgctgacattgccagagctgagatgttgttagaagaagctcaaaga
gccagcaacagtgcaacagatgttaaagtcactgcagacatggtaaaggaagctctggaa
gaagcagaaaaggcccagattgcagcagagaaggcaattaaacaagcagatgaagacatc
caaggaacccagaacctgctaacttcaatcgagtctgaaacagcagcttccgaggaaacc
ttgctcaatgcctcccagcgcctcagcgagctagagagaaacgtggaagaacttaagcgg
aaagctgcccagaactccggggaggcagaatatatcgaaaaagtagtatatactgtgaaa
caaagtgcagaagatgttaagaagactctggacggtgaacttgacgaaaagtacaagaaa
gtggaaaatataattgcccaaaaaactgaagagtcagctgatgccagaaggaaggctgaa
ctgctccaaaacgaagcaaaaacacttttggctcaagcaaacagcaagctgcaactcctg
aaagatttagaaagaaaatatgaggacaatcaaaaatatctagaagacaaagctcaagaa
ttagtaagactggaaggagaagtccgttcactcctaaaagatataagccagaaagtggct
gtttacagcacctgcttgtaa

KEGG   Delphinapterus leucas (beluga whale): 111184566
Entry
111184566         CDS       T05885                                 

Gene name
LAMB4
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit beta-4
  KO
K06245  laminin, beta 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111184566 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111184566 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184566 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184566 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184566 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184566 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111184566 (LAMB4)
   05145 Toxoplasmosis
    111184566 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 111184566
NCBI-ProteinID: XP_022448936
UniProt: A0A2Y9PUQ4
LinkDB
Position
Unknown
AA seq 1767 aa
MQFQLTYILHLGLLSYMEAQDECNRGACRPPTSNLLVGCSAQLSASTCGLGGTQKYCILS
YLEGEQKCLICDSRFPYDPHAQPNSHTTENVIPSFEPDGEEKWWQSENSLDHVSIRLDLE
ALFQFNQLILTFKTFWPAAMXIECSTDYGHTWRVFKYFAKDCATSFPNITSGQAHGVGDL
LCDSKYSDTEPSTGGEVVXKVLGPSFEIENPYSPYVQDLVTLRNLRMNFTKLHIVGDTLL
GRTQNDSLDKYYYALYEMVAXGSCFCSGHASXCGPTQKLSGEVFSPPGMVHGRCICQRST
DGPNCERCKDFFQDVPWRLAVGPLDSTCRACRCNGHSDRCHFDKTVYLASGSRRGYVCDG
CRHNTEGQHCDRFRPLFYRDPLKAISDPYACIPCKCDTDGTISGGLSVSCSDPDLGSLAG
QCLCXGAECDRCKTNHYGLTVTDPLGCQPCDCNPLRIMPLLTCDVETGQCLCQSLATGPH
CEECTVGYWGLENHLHGCSPCHISLGHAYSHRCSPEDGQCDCRPHVPGRSCTEPAPSYFF
APLNFYVYEAAEATPLQGLAPLAPETLCLFLSGQLPAVSVVLRGLVPGVPVTWMGPGFAR
VLAGPGLRFAVGNIPIPMDFAVAIRYEAQSADDWTVQMVVNLAGGSDHSARETPRPKPQP
LPAASRIMLLPTPICLEPDVQYSIDVYFPQPLEGEFQAHSHIELILXVHLIPQINSLENF
CSKQDLDEYRLHNCVEIASVMGPQVLPGACERLIASLSARLHNGAMACNCHPQGSVGPNC
SXLEGQCQCKPRVTGRCCDTCSTGSYSLGHHGCHSCHCHPQGSQNTVTGRCDQVTGRCPC
HGEVAGCYCDRCLEGSSGFPNCRPCLCNGFTXSCFSCGGFTTGRNCERCIDGYYGNPSSG
QSCCPCPCPDVPSSNQHFAHSCYQSPWSSDAICNCLQGYSGVQCGERSAGFYGNPRISGA
ACGPCACNXHVDVTDPESCSPVTGEDLKCLHNTQGPSCQLCRPGYFDPRSDLKLFAGVVD
ASVITDLPPNDGSVLPGCSCHPSGVSPSECPPGGGACLCDADTGTRPCMPNVTGRACDHR
ADGCWNVIAGRRCQPWDREPWTSLSRHCDQLTGQCPCRLGYDGKRCSECEENYYGDPLGR
CIHEYWXFXKPCDCNGKDSQKHICDQDMGTCHCREGVSGPRCDRCAQGHSQKFPACLRCH
LCFDPWDHTISSLSKAVQGLIRLAANMEDKRETLPVCEADFKGLRENMSEIERIWRHPVF
SSGEFLKVKDYHDSVRKEIIQLSDQRKTVYEFQDLKERRGRTRNKVNLLLEDLQEEIDLH
SRARNASIMDSSKSIRKYYQSSXSAEKKTNETTSIIDNSKKNRNDLLTILDTLTSKENLS
LEKLKQIQIPDIQTLHEKVYGGGNMPCVLLSCGGPSCPGXLTLSRNTLHKAQEAEFVIRN
LNSQVQGLKNQIKNISKLAEVSKNNALQLSEKLRNMKNQSVSEEEKMSLLIKKLKMFLLE
DNAPPEDIERVANRVLDIHLPVTSQNLTHEFDKIRKLLQLCEDYRTEENRLHTAADGARK
VLVKAKAAXKAANVLLNLDKMLNKLQQVQITQVRADSTITQLTAQITKIKKNALQAENQA
RETELDLAKQQSALEGGLARLQTKLQRNRDEAVRVGAQAESAQRQAGGLEEELVELQCRX
AILQHKTSAPGLTKETLGKMKQLRDAXKLAADTEDKIRRITDLETKIQALNLSRQEKADQ
LKQLEGQVIAIKKEIIEQENKYATCYS
NT seq 5304 nt   +upstreamnt  +downstreamnt
atgcagtttcaactgacctatattttgcaccttgggttgctcagttacatggaagctcaa
gatgaatgcaacagaggtgcttgtcgcccccccaccagcaatctcctggtgggttgcagc
gcgcagctctctgcttctacctgtgggctgggcgggacccagaaatactgcatcctcagt
taccttgagggggaacaaaaatgcctcatctgtgactccagatttccatatgatccgcac
gcccaacccaacagccacaccactgagaatgtaatcccaagttttgaaccagatggagaa
gaaaaatggtggcaatcagaaaacagtcttgatcatgtcagcatcagactggatctagag
gcattatttcagttcaatcaacttattctgacatttaagactttttggcctgctgcaatg
tgaattgaatgctccacagactatggacacacctggagagtgttcaaatattttgccaaa
gactgtgctacttccttccccaacatcacatctggccaggcccacggagtgggagacctt
ctttgtgactccaaatattcagatactgaaccctccactggtggtgaggttgtttaaaaa
gttttgggtcccagctttgaaatagaaaatccttacagcccctacgtccaggaccttgtg
acattaagaaacctgaggatgaactttaccaaactccatatcgtcggggatactttgctt
ggaaggacgcaaaatgattcccttgataaatactactatgctctgtatgagatggtggct
ncaggaagctgtttttgcagtggccacgctagctaatgtggcccaacacagaagctgagc
ggagaagttttcagccctcccggaatggttcatggtcgatgcatctgtcagcgcagtaca
gatggcccgaactgtgagaggtgcaaggacttcttccaggacgttccctggaggctagcc
gtgggccccctggacagcacatgccgagcttgtcgctgtaacggacactctgaccgctgt
cacttcgacaagaccgtgtacctggcgagcgggagtcgcagagggtacgtgtgtgacggc
tgccggcacaacaccgagggccagcactgtgatcgcttcagaccccttttctacagggac
cccctcaaggccatctcggatccgtacgcgtgcattccttgtaaatgtgacactgatggg
accatttcgggtggcctttctgtgagctgctctgatcctgacttggggtctttggccggc
cagtgcctgtgtnaaggagccgagtgcgaccggtgcaagaccaaccactacggactgact
gtcaccgaccccctgggctgtcagccctgtgactgtaaccccctaaggattatgccactc
ttgacctgtgatgtggaaacaggccaatgcctgtgtcagtctcttgctactggaccacac
tgtgaagaatgcacggttggatactggggactggaaaatcacctccacggatgttctccc
tgtcacatttcacttggacatgcttatagtcataggtgctcacccgaggatgggcagtgt
gattgtcgtccacatgttccaggtcgcagctgcactgagccagcgcccagctatttcttt
gctcctttgaatttctacgtctacgaggcagcggaagccacaccactccagggactggct
cctttggctcctgaaacattgtgtttattcctctctggccagctgcctgctgtttctgtc
gttctccgagggctagttcctggggtgcctgttacgtggatgggacctggatttgccagg
gttctcgctgggcccggcttgagatttgctgtggggaacatccccattcccatggatttt
gctgttgccattcgctatgaagctcagtctgcagatgactggactgtccagatggtggtt
aacctggccggagggagcgatcacagtgcacgcgagaccccacggccaaagcctcagcct
ttaccagcagcttccagaatcatgctgcttcccacacccatctgtttagaaccagatgta
caatattccatagatgtctattttccccagcctttggaaggagaattccaggctcattca
cacattgaattgattctataagttcatcttattccccaaatcaactcattggagaatttc
tgcagcaagcaggatttagatgaatatcgcctgcacaactgtgttgaaattgcctcggta
atgggacctcaggtgctccctggagcatgtgaaaggcttatagccagtttgtctgccagg
ctgcacaacggggccatggcctgcaactgtcacccacagggctcagtgggacccaactgc
agctgactggaaggccagtgccagtgtaagcctcgtgtgaccggccgctgctgtgacacg
tgctcaacaggaagctacagtttggggcatcacggctgtcactcatgtcactgccaccct
caaggctcacagaacactgtaacaggacgatgtgaccaagtaacaggacggtgcccctgc
cacggagaggtagctggctgctattgtgatcggtgcctggagggctcttctggatttcct
aactgccgcccctgcctttgtaatgggttcactnngtcatgcttcagttgtggaggtttt
acaactgggagaaactgtgaaagatgcatcgatggttactatggaaatccttcttcagga
cagtcctgctgtccttgcccgtgtccagatgttccctcaagcaatcagcattttgcccat
tcctgttatcagagtccttggagctcagatgcaatctgcaattgtcttcaaggttattct
ggtgtgcagtgtggagaacgctctgctggtttctatggaaatccaagaatttcgggagcc
gcctgtggaccttgtgcctgcaacnagcacgttgatgtaactgatccagagtcctgcagc
ccagtcacgggggaggaccttaaatgtctgcacaacactcaaggccccagctgccagctc
tgcaggccaggttactttgaccctcgatcagacctaaagttgtttgcaggggttgttgat
gccagcgttatcacggatttaccccccaacgacggctctgtgctcccagggtgttcctgt
catccttccggcgtgagtccctctgagtgtccccctggtggaggagcttgcctctgtgac
gctgacaccggcacacgcccttgtatgcccaacgtcacaggccgggcctgtgaccatcgt
gctgatggatgctggaatgtcatcgccggcagacgatgtcagccatgggatcgtgagccc
tggacctcactcagtagacactgtgaccagcttacaggccagtgtccgtgtagattaggc
tatgatgggaaacgctgcagtgagtgtgaggaaaattattatggggatcccctggggcga
tgcattcatgagtattggtaattctgaaaaccatgtgactgcaacgggaaagattcccag
aagcacatctgtgaccaggacatgggcacgtgtcactgccgagagggtgttagcggccca
cgatgtgatcgctgcgcccagggtcacagccagaaattccctgcttgtcttcggtgtcac
ttgtgctttgatccatgggaccacaccatttcttccctctccaaagcggtgcaagggtta
attaggctggctgctaacatggaagataaaagagagaccctgcctgtctgtgaggccgac
ttcaaaggcctcagagagaacatgtctgaaatagaaaggatttggagacatcctgttttc
tcatctggggaattcttaaaagtcaaggattatcatgactctgttcggaaagaaatcatt
caactaagtgaccagaggaaaacagtgtatgaatttcaagatctgaaagaaagaagagga
agaacgaggaataaagtgaacctcttacttgaagatcttcaagaagaaattgatttgcac
tcccgtgcccgtaatgcaagcatcatggattcctcaaagagcatcaggaagtattaccag
agctctnnatctgctgaaaagaaaactaatgaaactacttccatcatagataactctaaa
aaaaacaggaatgacttacttaccatcttagatacactaacctcaaaagaaaacttgtca
ttggagaaattaaagcagatccagataccagatattcaaacattgcatgaaaaggtgtat
ggaggagggaacatgccctgtgtgctcttgtcctgtggtggcccgagctgtcccggcntc
ctgaccctctcgaggaacaccctccacaaagctcaggaagcagagttcgtgattcgcaat
ttgaacagccaagttcaagggttgaaaaatcagatcaaaaatataagtaaactggcagaa
gtctccaaaaacaatgccttacagctaagtgagaaactgaggaatatgaaaaatcaaagt
gtatctgaagaagaaaaaatgagtcttttaatcaagaaactgaaaatgttcttattagag
gataacgcgcctccagaggacatagagagggttgcaaatcgtgtacttgacatccaccta
ccagtaacatcgcaaaatctgacccatgaatttgacaaaatacggaaacttttgcaactc
tgtgaggactacaggacagaggagaacaggctacatacagcagcagatggagcccgaaag
gttttggtgaaggcaaaagcagcttaaaaagcagcaaatgttctattaaatctcgacaaa
atgttgaataagttgcaacaagttcaaatcactcaagtacgggcagattctaccatcaca
cagctgactgcccagataacaaaaataaaaaagaacgcactgcaggctgaaaatcaggcc
cgggagactgagctggatttagcaaagcaacagtcagcgctggagggtggacttgcccgg
ctgcagaccaagttgcaaaggaatagagacgaggccgtccgtgtgggagctcaggctgaa
tcggcccagcgccaggctgggggccttgaggaggagcttgttgagctacaatgtcgataa
gctattcttcagcataagacaagcgcgccaggactgacaaaggaaaccttagggaaaatg
aaacagctaagagatgcangcaaactggctgcagatacagaggacaagataagaagaata
acagatttagaaacaaagatccaagctttgaatctaagtagacaagaaaaagctgatcag
ctgaaacagttggaaggtcaagtcattgccattaaaaaagaaattattgagcaagaaaat
aaatatgctacctgctacagttag

KEGG   Delphinapterus leucas (beluga whale): 111184636
Entry
111184636         CDS       T05885                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05020  Prion disease
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111184636 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111184636 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184636 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184636 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184636 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    111184636 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184636 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111184636 (LAMC1)
   05145 Toxoplasmosis
    111184636 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 111184636
NCBI-ProteinID: XP_022449023
UniProt: A0A2Y9Q0S7
LinkDB
Position
Unknown
AA seq 1608 aa
MRGSKPAAPALRPRGGLWRVLAVLAAAAAGCARAAMDECTDEGGRSQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREEGPWVPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCSGRSQECYFDSELYRST
GHGGHCTNCQDNTDGANCERCRENFFRLGNREACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSTDECNFETGRCVCKDNVEGFNCERCKPGF
FNLESSNPMGCTPCFCFGHSSVCTNAVGYSVYSITSTFQTDEDGWRVEQRDGSEASFEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNFSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPETGVCNCRENTAGPHCEKCSDGYYGDSTVGTSSDCQPCPCPGGSSC
AVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACDCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIHTGQCECQPGIT
GQHCEHCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGLCECKEGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRAKLQELENLIANLGTGDEMVTDQAFEDRLKEAERE
VTDLLREAQDVKDVDQNLMGRLQRVNNTLFSQISRLQNIRNTIEETGNLAEQACARVEST
EQLIEIASRELEKAKVAIANVSITQPESTGDPNNMTLLADEARKLAERHKQEADDIVRVA
KAANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAG
EKAVEIYASVAQPTPVDSEARENEANKIKKEAEDLDRLIDQKLKDYEDLRQDMRGKEFEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILSNLKDFDRRVNDNK
TAAEEALRRIPAINQTIIEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSNL
ENEARRQEAAIMDYNRDIEEILKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 4827 nt   +upstreamnt  +downstreamnt
atgaggggcagcaaaccggccgcgccggcgctgcggccgcggggcggcctctggcgggtg
ttggctgtgctggcggccgctgcggccggctgcgcccgggcagccatggacgagtgcacg
gacgagggcgggcggtcgcagcgctgcatgcccgaattcgtcaacgccgccttcaacgtg
accgtggtggccaccaacacgtgcgggactccgcccgaggagtactgtgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcac
ggggcagccttcctgacggactacaacaaccaggccgacaccacctggtggcagagccag
accatgctggccggggtgcagtaccccaactccatcaacctcacgctgcatctgggaaaa
gcgtttgacatcacatacgtgcgcctcaagttccacaccagccgcccggagagcttcgcc
atttacaagcgcacgcgggaagaggggccctgggtcccttaccagtactacagcggctcc
tgcgagaacacctactcgaaggcaaaccgaggcttcatcaggacgggaggggacgagcag
caggccttgtgcacagatgaattcagtgacatttcccctctcactgggggcaacgtggcc
ttttcaaccctggaaggaaggcccagtgcctacaactttgacaatagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaacactcaatcgcctgaacacttttggggat
gaagtgtttaatgaccccaaagttctcaaatcctattattatgcaatctctgatttcgct
gtgggtggtaggtgtaaatgtaacggacatgcaagcgagtgcgtgaagaatgaatttgac
aagctggtgtgtaattgcaaacataatacttacggagtagactgtgagaagtgccttcct
ttcttcaatgaccggccgtggaggagggcgactgccgagagtgccagcgaatgcctgccc
tgtgactgcagtggccgatcgcaggaatgctactttgactctgaactataccgttccacg
ggccatggtggccactgtaccaactgccaggataacacggacggcgccaactgtgagagg
tgccgggagaatttcttccgccttgggaacagagaagcctgctctccctgccactgtagt
cctgttggttctctcagtacacagtgcgatagctatggcagatgtagctgtaagcctgga
gtgatgggggacaaatgcgaccgttgccagcctgggtaccattctcttactgaggctgga
tgcaggccatgctcttgtaatccttctggcagcacggacgaatgtaattttgaaacagga
agatgtgtttgcaaagacaatgtcgaaggcttcaattgtgagagatgcaaacctggattt
tttaatctggaatcatctaatcctatgggttgcacaccttgcttctgctttgggcattct
tctgtctgtacaaatgctgtcggctacagtgtttattctataacctctacctttcagaca
gatgaggatgggtggcgtgtggaacaaagggatggctctgaagcatcatttgagtggtcc
tctgagaggcaagatatcgctgtcatttcagatagctactttcctaggtacttcattgcc
cccgcaaagttcttgggcaagcaggtgttgagttatggtcagaacttctccttctccttt
cgagtggacaggcgagacactcgcctctctgcagaagacctggtgcttgagggagctggc
ctaagagtgtctgtgcccttgatcgctcagggcaattcctatccgagtgagaccactgtg
aaatatgtcttcaggctccatgaagcaacagattacccttggaggcctactcttacccct
ttcgaatttcagaaactcctaaacaatttgacctctatcaagatccgtgggacatatagt
gagagaagcgctggatatttggatgatgtcaccctggccagcgctcgtcccgggcctggg
gtccctgcaacttgggtggagtcctgcacctgtcctgtgggatacggagggcagttttgt
gagatgtgcctctcaggttacagaagagaaactccgagtcttggaccatacagtccatgt
gtgctttgtacctgcaatgggcacagtgagacctgtgaccctgagacaggtgtttgtaac
tgcagagagaatacagccgggccccactgtgagaaatgtagtgacgggtactatggagat
tcaaccgtgggcacctcctctgattgccagccctgtccgtgtcctgggggctccagttgt
gctgttgtccctaagacacaggaggtggtgtgcaccaactgtcctactggcaccactggt
aaaagatgtgagctctgtgatgacggctactttggagaccctctgggtagaaacggccct
gtgaggctttgtcgcctgtgccagtgcaatgacaacatcgatcccaatgcagttggaaat
tgcaatcgcttgacaggagaatgcctgaagtgcatctataacacggctggcttctactgt
gaccggtgcaaggacggattttttggaaatcccctggctcccaatccagcagacaagtgc
aaagcctgcgactgcaacccctacgggaccgtgaagcagcagagcagctgtaaccctgtg
accgggcagtgtgagtgtctgcctcatgtgaccggccgggactgtggagcttgtgaccct
ggattctacaacctgcagagcgggcagggctgtgagaggtgtgactgccatgctttgggt
tccaccaatggacagtgtgacatccacactggccagtgtgagtgccagcctggcatcacc
ggtcagcactgcgagcactgcgaggtcaaccactttgggtttggacctgaaggctgtaaa
ccctgtgactgtcatcctgaggggtctctttccctccagtgcaaagatgatggtctctgt
gaatgcaaagaaggctttgtggggaatcgctgtgaccagtgtgaagagaactatttctac
aatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtaaaggataag
gttgctgatcatcgagcaaaactccaggaattagagaatctcattgcaaaccttggaact
ggggatgagatggtgacggatcaagcctttgaggatagactaaaggaagcagagagagag
gtgactgacctccttcgtgaggcccaggatgtcaaagatgtagaccaaaatttgatgggt
cgcctccagagagtgaataacaccttattcagccaaattagccgattacagaatatccgg
aataccattgaagagactggaaacttggctgaacaagcatgtgcccgggtagaaagcaca
gagcagttgattgaaatcgcatccagagaacttgagaaagcaaaagttgccattgccaat
gtgtcaatcactcagccagaatctacaggggacccaaacaacatgactcttttggcggat
gaggcacgaaagcttgctgaacgccataaacaagaagctgatgacattgtacgagtggca
aaggcagccaatgatacatcaactgaggcatataatctgcttttgaggacactggcagga
gaaaatcaaacagcatttgagattgaagagcttaatagaaagtatgaacaagcgaagaac
atctcacaggatctagagaagcaagctgcccgagtacatgaggaggccaagagggctggt
gagaaagctgtggagatctatgccagtgttgcccagccgactcctgtggactcagaagcc
agggagaatgaggcaaataaaataaagaaggaagctgaggatctggatcgtctgattgac
cagaagttaaaagattatgaggacctcagacaggacatgagagggaaggaatttgaagta
aagaaccttctggaaaaaggaaagaccgaacagcagactgccgaccaactcctagcccga
gcggatgctgccaaggctcttgcggaagaagctgctaaaaagggacgaaataccttacaa
gaagccaatgacattctcagcaacctgaaagattttgatagacgagtaaatgataacaag
acggctgcagaggaggcactaaggagaatccctgccatcaaccagactataattgaagcc
aatgaaaagaccagggaagcacagctggctctgggcaatgctgccgcagatgccaccgag
gccaagaacaaggcccacgaggcggagaggatcgccagcgctgtccaaaagaatgctacc
agcaccaaggcagaagctgagaggacttttgcagaagttacagatctggataacgaggtg
aataatatgttgaaacagctacaggaagcagaaaaggagctgaagaaaaaacaagatgat
gctgaccaggatatgatgatggcagggatggcttcacaggctgctcaggaagctgagatc
aatgccagaaaggccaaaaactctgtcaccagcctcctcaaccttattaatgacctcctg
gagcagctggggcagctggacacagtggacctgaacaagctaaatgagattgaaggtacc
ctgaacaaagccaaagatgaaatgaaagtcagtgatctagacaggaaagtgtctaacctg
gagaatgaagccaggaggcaggaggctgccatcatggactataacagagacattgaggag
atcctgaaggacatccgcaacctggaagacatcaagaagaccttaccctccggctgcttc
aacaccccgtccattgaaaagccctag

KEGG   Delphinapterus leucas (beluga whale): 111184637
Entry
111184637         CDS       T05885                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111184637 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111184637 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184637 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184637 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184637 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184637 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111184637 (LAMC2)
   05145 Toxoplasmosis
    111184637 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B DUF5660
Other DBs
NCBI-GeneID: 111184637
NCBI-ProteinID: XP_022449024
UniProt: A0A2Y9PQ73
LinkDB
Position
Unknown
AA seq 1191 aa
MPALWLSCCLCFSLLLPAARANSRTPVCDCSGKSRQCVFDEELHRLTGNGFRCLHCSDNT
GGVHCQRCKEGFYRQRDRDRCLPCNCNSKGSLSARCDNAGRCSCKPGVTGDRCDRCLPGF
HTLTEAGCTQDQRLLDSKCDCDPAGISGPCDTGRCVCKSAVTGGHCDRCRPGYYHLDGGN
PEGCTQCFCYGHSASCRSSGDYSVHKITSTFHQDVDGWKAVQRNGSPAKLQWSQRHRDVF
SSARQSDPVYFIAPAKFLGNQQVSYGQNLSFDYRVDRGGRHPSAHDVILEGAGLWITAPL
IPPGKTLPCGVTKTYTFRLNENPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYL
DNVTLISARPISGAPAPWVEQCVCPVGYKGQFCQECASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPRDPRSCKPCPCRNGFSCSVMPETEEVV
CNNCPHGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CLHGTAGTHCDQCKAGYFGDPLAPNPMDKCRACNCNPVGSEPVECRSDGSCVCKPGFGGL
NCEHAALTICPACYNQVKIQMDQFMQQLQNLETLISKAQGDGGAVPNTELEGRMQWVEQT
LRDILREAQISEGAIRSLNLQLAKARSQENSYRNRLDDLKMTVERVRTLGSQHQNRVQDT
HRLITQMRLSLEESEAALRNTDVPPSEDYMGPNGFKSLAQEAARLADSHVESANNMEQLA
RETEDYSEQALSLARKALSEGGGSGTLDGSVVQGLVGKLEKTKSLAQQLSREATQTDIEA
DTSYQHSLRLLNSASQLQGVNDQSFQVETKRIRQKADSVSSLVTKHVDEFKRVQSNLGNW
EEETRKLLQNGKNGRQKSDQLLSRANLAKSRAQEALSMGNATFYEVENILKNLREFDLQV
EDRKAEAEEAMKGLSYISQKVADASDKTKQAETALGDAAADAQRAKNAAGEALEITGNIE
QEMGSLNLEANVTADGALAMEKGLATLKSEMREVEGELARKEREFDTSTDAVQTVITEAQ
RVDNRARNAGVTIQDTLNMLDGILHLIDQPGSMDEEGLILLEQKLFQAKAQINSQLRPLM
SKLEERASCQRGHLRSLETSIDGILADVKNLENIRDNLPPGCYNTQALEQH
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctcagctgctgcctctgcttctcgctcctcctgcctgcagcccgg
gccaactccaggacgccagtctgtgattgcagtgggaagtccaggcaatgcgtgtttgat
gaggaacttcacagactgacaggaaatggattccgctgcctgcactgcagtgacaacacg
ggtggcgttcactgccagaggtgcaaggaaggattttaccgccagagagacagagaccgc
tgtttaccctgcaattgtaactccaaaggttctcttagcgctcgatgtgacaatgctgga
cgatgcagctgtaagccaggtgtgacaggagacaggtgtgaccgctgtctgccaggcttc
cacaccctcactgaggctgggtgcacccaagaccagagactcctggactccaagtgtgac
tgtgatccggctggcatctcggggccctgtgacacaggccgctgtgtctgcaagtcagct
gtcaccggagggcactgtgataggtgccgaccaggttactatcacctggatgggggaaac
cctgagggctgtacccagtgtttttgctacggccattcagccagctgccgaagctctgga
gactacagtgtccataaaatcacctctaccttccatcaagatgttgatggctggaaggct
gtccaaagaaatgggtctcctgcaaaactccaatggtcacagcgccatcgagatgtgttt
agctcagcacgacagtcagaccctgtctattttatagctcctgccaaatttcttgggaat
caacaggtgagctatgggcaaaacctgtcttttgactaccgtgtggacaggggaggcaga
cacccatccgcccatgatgtgatcctggaaggtgctggtctatggatcacagctcccttg
attccacctggcaagacactgccttgtggggtcaccaagacttacactttcagattaaat
gaaaatccaagcagtaattggagcccccagctgagttactttgagtatcggaggttactg
cggaacctcacagccctgcggatccgagctacctatggagaatacagtactgggtacctt
gacaatgtgaccctgatctcagctcgccccatctctggagccccagcaccatgggttgaa
caatgtgtgtgtcctgttgggtacaagggacagttctgccaggaatgtgcttctggctac
aaaagagattcagccagactgggaccttttggcacctgtattccatgtaactgccaagga
ggaggggcttgtgatccagacacaggagattgttattcaggggatgaaaaccctgacatc
gagtgtgccgactgccccattggtttctacaacgacccacgtgacccccgcagctgcaag
ccctgcccctgtcgcaatgggttcagctgctccgtgatgcccgagacagaggaggtggtg
tgcaataactgtccccacggtgtcaccggtgcccgctgcgagctctgtgccgatggctac
tttggggacccctttggggaacacggcccagtgaggccttgtcaaccctgtcagtgcaac
aacaatgtggaccccagtgcctctgggaactgtgaccgcctgacgggcaggtgtctgaag
tgcctccacggcacagccggtacccactgtgaccagtgcaaagcaggctactttggggac
cccttggctcccaacccaatggacaagtgtcgagcttgcaactgcaacccagtgggctcg
gagcccgtggagtgtagaagtgatggcagctgtgtttgcaagccaggatttggcggcctc
aactgtgagcatgcagcattaaccatctgtccagcttgctataatcaagtgaagattcag
atggatcagtttatgcagcagctccagaacctggagaccctgatttcaaaggctcagggt
gacggtggagcagtacccaacacagagctggagggcaggatgcagtgggttgagcagacc
cttcgggacattctgagagaagcccagatttcagaaggtgctattagatccctcaatctc
cagttggccaaggccaggagccaagagaatagctaccggaaccgcctggatgacctcaag
atgactgtggaaagagttcggaccctgggcagccagcatcagaaccgagttcaggatact
cacaggctcatcactcagatgcgcctgagcctggaggaaagtgaagctgccctgcgaaac
accgacgttcctccctcagaggactatatggggccaaacggctttaaaagtctagctcag
gaggccgcgagactggcagacagccacgttgagtcagccaataacatggagcaactggcc
agggaaaccgaggactactccgaacaagccctatccttggcgcgcaaggctctgagtgaa
ggaggcggaagcggcacgctggacggctccgtggtgcaagggcttgtgggaaaattggag
aaaaccaagtctctggcccagcagttgtcaagggaggccactcaaactgacattgaagca
gatacgtcttatcagcatagtctccgccttctcaattcagcatctcagcttcagggggtc
aatgatcagtcctttcaggtagaaacgaagaggatcagacaaaaagctgactctgtctca
agcctggtgactaagcatgtggatgagttcaagcgtgtgcaaagcaatctgggaaactgg
gaagaagaaacccggaagctcttacagaatgggaagaatgggagacagaaatcagatcaa
ctgctttcccgtgccaaccttgctaaaagcagagcccaagaagcactaagtatgggcaat
gccactttttatgaagttgagaacatcttaaagaacctcagagagtttgacctgcaggtt
gaagacagaaaagcagaagctgaagaggccatgaagggactctcctacatcagccagaag
gttgcagatgccagcgacaagaccaagcaagcggaaacagccctgggcgatgctgctgcc
gacgcccagagggcaaagaacgcagccggggaagccctggagatcaccggcaacatagaa
caggagatggggagtctgaacttggaggccaacgtgacagcagatggagccttggccatg
gagaagggactggccactctcaagagtgagatgagggaagtggaaggagagctggcaagg
aaggagcgggagtttgacacgtctacggatgcagtgcagacggtaatcacagaagcccaa
agagttgataacagagccaggaatgctggagttacgatccaagacacacttaacatgttg
gacggcatcctacacctaatagaccagcctggcagtatggatgaagaggggctgatctta
ttggagcagaagcttttccaagccaaggcccagatcaacagtcagctgcggccgttgatg
tcaaagctggaagagagggcaagctgtcagaggggccacctccgttcactggagacgagc
atagatgggattctggctgatgtgaagaacctggagaacattagggacaacctgccccca
ggctgctacaacacccaggctcttgagcagcactga

KEGG   Delphinapterus leucas (beluga whale): 111184724
Entry
111184724         CDS       T05885                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111184724 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111184724 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184724 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184724 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184724 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184724 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111184724 (LAMB3)
   05145 Toxoplasmosis
    111184724 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II BNR_6 F5_F8_type_C
Other DBs
NCBI-GeneID: 111184724
NCBI-ProteinID: XP_022449209
UniProt: A0A2Y9PVI1
LinkDB
Position
Unknown
AA seq 1172 aa
MRPILLLYFVLPSILCAQQACSRGACYPPVGDLLIGRTRFLRASSTCGLAKPETYCTQYG
EWQMKCCKCDSRLPHNYNSHRVENVVSSSGPMRWWQSQNDVSPVSLQLDLDRKFQLQDIM
MDFKGPTPAGMLIERSSDFGKTWQVYQYLAADCTSAFPRVRRGQPQSWQDARCQPLPQRP
NRRLDGAKVQLNLMDLASGIPATQSQKIQELGAITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPNSRAPASPSTTVQVHGVCVCQHNTAGSNCEHCAPFYNNK
PWKPADDQDPHECQRCDCNGHSETCHFDPAVFTASQGAHGGVCDNCQHHTEGKNCERCQL
HYFRNRRPGAPIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEQVQGERCDLCKPGFTGL
TYANPQGCHRCDCSVLGARRDMPCDEESGRCLCLPHVVGPKCDQCARYHWKLASGRGCEP
CACDPHNSLSPQCNQFTGQCPCQEGFGGLTCNAAAIRQCPDKTYGDAAMGCRACDCDFRG
TEGPGCDKASGRCLCRPGSTGPRCDQCQRGYCDRYPVCVACHPCFQTYDTGLRERALRLS
GLRNATTSLWPGPGLEDRGLASRMLDTKNKLEQIQAILGGASVTEQEVAQVANAIVSIRQ
TLQGLQVDLPLEEETLSLPGDLENLDRSFNRLLVMYQSKREQFEKISSADPSGAFRMLTA
AHQRSSQAAQQVADSSRRLLQLRDSRREAERLEQQLGGAGGAGGPQLAALRLQMASLPDL
TPAANKLCGGPREMACTPGACPGELCPRDNGTACGSHCRGALPRAGGAFRTAGQVAEQLR
GFNAQLQQTRQMIRAAEEATLQVQSDAQSLEMQVSTSRSQMEEDVTRTRLLIQQVRDFLS
DPDTDVATIQEVSEAVLALWLPTDSATVLRKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAAAEQARSRAHTVEGQVEDVLGNLRQGTLALQEAQDTMQGTRRSLQLIQDRVAEVQQ
VLGPAERLVTSLMEQLGGFRARMEELGHRARQQRAQAAQAQHLAEEASKQALSAQEGFER
IKQKYAELKDRLGQSPTLGEQGSRILSIKMEAEELFGETMEMMDKMKDMESELLRGSQAI
MHRSADLTGLEKHVEQIRNHINGRVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaggccgatccttctcctgtattttgtcttgcccagcatcctgtgtgcccagcaagcc
tgctcccgtggggcctgctatccacccgttggggacctgctcattgggaggacccggttt
ctccgagcttcatctacctgtggcctggccaagcctgagacctactgcacccagtatgga
gagtggcagatgaaatgctgcaagtgtgactccaggttgcctcacaattacaacagtcac
cgagtggagaatgtggtctcgtcctcgggccccatgcgctggtggcagtcacagaatgat
gtgagccctgtctctctgcagctggacctagacaggaaattccagcttcaagacatcatg
atggattttaaggggcccacgcctgctggcatgctgatcgagcgctcctcggacttcggc
aagacctggcaggtgtaccaatacctagctgccgactgcacgtctgccttcccccgggtc
cgccggggccagcctcagagctggcaggatgctcggtgtcagcctctgccccagaggcct
aacaggcgcctggatggggccaaggtccagcttaaccttatggatttagcctctgggatc
ccagcaactcaaagtcaaaaaattcaagagctgggggcgatcacaaacttgagagtcaac
ttcaccaggctggcccctgtgccccagaggggctatcaccctcccagcgcctactatgct
gtttcccagctgcgtctgcaggggagctgtttctgtcatggccatgctgaccgctgtgcc
cccaattccagagcccctgccagcccctccaccactgtgcaggtccatggggtctgcgtc
tgccagcacaacaccgccggctccaactgtgaacactgtgcacccttctacaacaacaag
ccctggaaacctgcagatgaccaggacccccatgaatgccaaaggtgtgactgcaacgga
cactcagagacatgtcacttcgacccagccgtgtttaccgccagccagggggcacatggg
ggtgtgtgtgacaactgccaacaccacactgagggcaagaactgtgagcggtgtcagctg
cactatttccggaaccggcgtcctggtgctcccattcaggagacctgcatcccctgcgag
tgtgatccggatggggcagtgccaggagcgccctgtgacccagtgaccgggcagtgtgta
tgcaaggagcaagtgcagggggaacgctgtgacctgtgcaagccgggatttacaggactc
acctatgccaacccgcagggctgccaccgctgtgactgcagcgtcctgggtgcccggcgg
gacatgccgtgtgatgaggagagtggacgctgcctgtgtctgccccacgtggtgggcccc
aaatgtgaccagtgtgctcgctaccactggaagctggccagcggccggggctgcgagcca
tgtgcctgcgaccctcacaactccctcagcccccagtgcaaccagttcacagggcagtgc
ccctgtcaggaaggttttggtggcctgacctgcaacgctgcagccatccgccagtgtcct
gacaagacctacggagatgcagctatgggatgccgagcctgtgactgtgacttccgggga
acggagggaccaggctgcgataaggcctcgggccgctgtctctgccgccctggctcgacc
gggccacgctgcgaccagtgccagcgaggctactgtgaccgctatccggtgtgtgtggcc
tgccacccctgcttccagacctacgacaccggcctccgggagcgggccctccgcctcagc
ggcctccgtaatgccaccaccagcctgtggcctgggccgggcctggaggaccgcggcctg
gcgtcccggatgctggacacaaagaacaagctggagcagatccaagccatcctcggcggc
gcctcggtcacggagcaggaggtggcccaggtggccaatgccatcgtctccatcaggcag
actctccagggcctgcaggtggatctgcccctagaggaggagaccttgtccctcccggga
gacctggagaatctggacagaagcttcaatcgcctccttgttatgtatcagagcaagagg
gagcagtttgaaaaaataagcagtgccgatccttcaggagccttccggatgctgaccgcg
gcccaccagcggtcatcccaggctgctcagcaggtcgcggatagctcccgccggctgctg
cagctcagggacagccggagagaggcggagaggctggagcagcagctgggaggagcagga
ggggccggcggcccccagctcgcggccctgaggctgcagatggcttccttgcctgatctg
acacccgccgccaacaagctctgtgggggccccagggagatggcttgcaccccgggagcg
tgccctggggagctgtgtccccgagacaacggcacggcctgtggctcccactgcaggggt
gctctccccagggcaggtggggccttccggacggcagggcaggtggccgagcagctgcgg
ggcttcaacgcccagctccagcagaccaggcagatgatcagggcagccgaggaagccacc
ttgcaggtgcagtcagatgctcagagcctggaaatgcaggtgagcaccagccgctcccag
atggaggaagacgtcacacgcacgcggctcctcatccagcaggtccgagacttcctctca
gaccctgacactgacgtagccaccatccaggaggtcagtgaggccgtgctggccctgtgg
ctgcccacagactctgccacagtcctgcggaagatgaatgagatccaggccatcgcagcc
aggctccccaacgtggacctggtgctttctcagaccaagcaggacatcgctcgggctcgc
aggctccaggctgcggctgagcaggccaggagccgagcccacacagtggagggccaggtg
gaggatgtgctggggaacctgcgacagggcacgctggcactgcaggaggcccaggacacc
atgcaaggcacccgccgctcccttcagcttatccaagacagggttgctgaggttcagcag
gtgctggggccagcggaaagactggtgaccagcctgatggagcagctgggtggcttccga
gcgcggatggaggagctcggccaccgggccaggcagcagcgggcacaggccgcccaggcc
cagcatctggcagaggaggccagcaagcaggcactgagtgcccaggagggatttgagaga
ataaagcaaaagtatgctgagttgaaggaccggctgggtcagagccccacgctgggagag
cagggcagccggatcttaagcatcaagatggaggcggaggaactgttcggggaaaccatg
gagatgatggacaagatgaaagacatggagtcggagctgcttcgggggagccaggccatc
atgcatcgctcggcggacctgacggggctggagaagcacgtggagcagatccggaaccac
atcaatgggcgcgtgctctactacgccacctgcaagtga

KEGG   Delphinapterus leucas (beluga whale): 111186816
Entry
111186816         CDS       T05885                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111186816 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111186816 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111186816 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186816 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111186816 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111186816 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111186816 (LAMA5)
   05145 Toxoplasmosis
    111186816 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 HSCB_C DUF948
Other DBs
NCBI-GeneID: 111186816
NCBI-ProteinID: XP_022453460
UniProt: A0A2Y9Q785
LinkDB
Position
Unknown
AA seq 3687 aa
MAKPGARPRRSRGPAPLLLAGLALLGAVRAREAAGSGFSLHPPYFNLAEGVRIAASATCG
EEAPTRGAPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAASSNRAHPVSNAVDGTE
RWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTDFGHTYQPW
QYFASSKRDCLERFGPRTLERISGDDDVICSTEYSRIVPLENGEIVVSLVNGRPGAMNFS
YSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCHGH
ADVCDAQDPTDPFRLQCACQHNTCGSSCDRCCPGFNQQPWKPATTDSANECQSCNCHGHA
HDCYYDPEVDRSNASQNQDRVYRGGGVCIDCQHHTSGINCEQCLPGFYRSPDHPLDSPHA
CRRCDCESDFTDGTCEDLTGRCYCRPNFTGARCDACAEGFSGFPSCHPVPSFSHNDTGEQ
VLPAGQIVHCDCSAAGTQGNACRKDPRVGRCVCKPNFQGTHCELCAPGFYGPGCQPCQCS
SPGVVDGTCDRDSGQCTCRAGFEGAACDRCAPGYFHFPLCQLCGCSPTGTLPEGCDDAGR
CPCRPEFDGPHCDRCRPGHHSYPECHACACDPRGALDQLCGAGGVCRCHPSYAGATCQEC
SPGFHGFPDCAPCHCSPEGSLHTACDPHSGQCSCRPRVTGLRCDMCVPGAYNFPYCEAGS
CHPAGLAPADHDLPEVHIPCRCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDPRGTL
GGVAECQPGNGQCFCKPHVCGHTCAACKDGFFGLDQADYFGCRGCQCDVGGALGQGCEPR
TGACLCRPSTQGPTCSKPAQDHYLPDLHQLRLELEEAATPEGHAVRFGFNPLEFESFSWR
GYAQMAPIQPRIVARLSVASPDLFRLVFRYVNRGPASVSGRVSVHDQGKFATCANCAEQS
QPVAFPPSTEPAFVTVPQRGFGEPFVLNPGAWALLVEAEGVLLDYVALLPSAYYEAALLQ
LRVTEPCTFQPDAQRSGDHCLLYTHLPLDGFPSATGPEALCRHGNSLPRPCPTEQLSPTH
PLLVACQGADVDVQLQVAVTQPGPYALVVEYANEDARQEVDVAVHTPQRAPQQGALTLHP
CPYSTLCRGTALDAQRHLAVFHLDTEASVRLTAEHARFFLHSATLVPAETFSSEFVEPRV
RCISSHGAFSPSSAACLPSRFPKPPQPVVLRDCQVLPLPPGLPLTHSRELTPGAPPPGPQ
PRPPTAADPDVEPTLLRHPQGTVVFTTHVPALGRYAFLLHGYQPAHPTFAVEVLINGGRV
WQGHANASFCPHAYGCRTLVVCEGRAVLDVTDSGLTVTVRVPEGRWLWLEYVLVVPEDAY
SPSYFREEPLDKSYDFISQCATHGYHVSSSSSSSFCRNAATSLSLFYNNGARPCSCHEVG
AVGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPSCRPCDCSGRLCDELTGQCICPPRT
VPPDCVICQPQTFGCHPLVGCEECNCSGPGVQELMDPTCDVDSGQCKCRPNVAGRRCDTC
APGFHGFPSCRPCDCHEAGSAPGTCDPLTGQCSCKENVQGPRCDQCRLGTFSLDVANPKG
CTRCFCFGATDRCRSSAYARREFVDMEGWTLLSGDRQVVPHERQAEATLLRADLRRVPEA
FPELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDVFIPTESRPDVVLQGNQMSIAFLE
PVYPAPGHVHRGELQLVEGNFWHMETRSAVSREELMMVLAGLEQLHIRALFSQTSSAISL
RRVALEVASEVGGGPPASNVELCMCPANYRGDSCQECAPGYYRDVKGLFLGRCIPCQCHG
HSDRCLPGSGICVGCQHDTEGDHCERCQAGFVRSGPEDPAAPCISCPCPLAVPSNNFATG
CILRGGRAQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNMLFSDCDPL
TGACRGCLRHTTGPRCESCAPGFYGNALLPGNCTRCDCSPCGTEACDPHSGHCLCKAGVT
GQRCDHCQEGHFGFEGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTGGLQCRECAPGHW
GLPEQGCRRCQCQGGHCDVHTGRCTCPQGLSGERCDTCSHQHQVPMPGGPGGHGVHCEVC
DHCVVLLLDDLERAGALLPAIREQLRGVNASSVVWARLHRLNASIADLQSQLRKPPGPRH
ETAQQLEALERQTSSLGQDVQQLDGQATGARAQAGQLLDSTEATLGRAQTLLAAVRAVDR
ALSELESQTDRLSPANASALSGEQLRRTLAEVERLLWEMRARDLGVPRAAAEAELGEAQR
LLAHVQEQLTRRWERNQALVARIRDQLAQHEAGLMDLREALNRAVGTTREAEELNSRNQE
RLEEALQREQELFRDNATLGATLQAARDTLVRLTELLRGMDQAKEEYEHLAASLDGAQTP
LLEKMRAFSPASSKVDLVEAAEAHAWQLDQLALNLSSIIQGVNQDRFIQRAVEAANAYSS
ILQAVRAAEGAAGQAQQQASRIWAVVVQRGLASRARELLADSSALEEAVLGEQRRLGLAW
ATLQGTGTRLRDARARKEQLAARLREVQAMLAMDTDETSKKIAHAKAVVTEAQDTAARVQ
SRLQDMQKNVERWQGQYKGLQSQDLGRVVLDAGRSVSTLEKTLPQLLAKLSLLQNRGTHN
ASLALSASIGRVRELIAQARGAADKVKVPMKFNGSSGVQLRTPRDLASLASYTALKFYLQ
SPEPLPGQVAGDQFVLYMGSRQATGDYMGVALRGQKVHWVYRLGGAGPTALSIDEDIGEE
FAAVSIDRTLQFGHMSVTVENQMVQETKGDTVAPGAEGLLSVQPDDFVFYVGGYPGNFTP
PEPLRFPGYRGCIELDTLNEEVVSLYNFEKTFQLDTAVDKPCARSKSTGDPWLTDGSYLD
GSGFARISVESQLSNTKRFEQELRLVSYSGILFFLRHQDQFLCLAVREGSLVFLYDFGMG
LKEADPLQRPPPLTTTSKAIQVFLLGGSRKRVLVRVERTTVFSVEQDSTLELADAYYLGG
VPPSQLPPSLRRLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISSGCTADLLVGRAMTF
HGHGYLRLALPSNAVPLTGNVYSGFGFRSSQDSALLFHRESPTGPCEVSLQQGHVTLRLA
RTEVKTRRGFADGAPHYVTFYSNATGVWLYVDDQLQEMRPHREPRPRPQPQPEGSSQLFL
GGLPKSDALRNFSGCISNVFVLRLLGPQRVFDLQQNLEGINVSSGCVPAPRTQAPDQSPR
GLRATKASRRSRQPAQDTSCSPPWPRRAIRDAYQFGGPLSSHLEFAHVPPPTSDWSQLSM
LIRPHAPRGLLLFAAPLTASSPSLVLFLSHGRFVAQTEGPGPQLRVQSRQRSRTGRWHTV
SVRWEKTRIQLVTDGVWAQSREGPGRRHQGEEGPRPHTLFVGGLPAGGHSPQLPVAISRS
GFSGCVKRLRLDGQLLGAPTRVVGATPCFSGPLEKGLFFAGSGGAITLDTLGATLPDLGL
ELEVRPQTATGLVFHLGRGPAPPYLELRVLGRQVLLRADDGSGEFSTLVTLPEALCDGQW
HRLAVTKGGNRLRLEVDLQSNHTLGPAPAAPADAPVPLYLGGLPEPWTRPPTYRGCMRNL
VVNQALVSWPRAAGVQGAVGASGCPAT
NT seq 11064 nt   +upstreamnt  +downstreamnt
atggcgaagccgggcgcgcggccccgccgttcccggggccccgcgccgctgctgctggcc
gggctggcgctgctgggcgcggtgcgggcgcgggaggcagcgggcagcggcttcagcctg
cacccgccctacttcaacctggcggagggcgtccgcatcgccgcctccgccacctgcggc
gaggaggccccgacgcgcggcgccccgcgccccaccgaggacctctactgcaagttggtg
gggggccccgtggccggcggggaccccaaccagaccatccagggccagtactgcgacatc
tgcacagctgcaagcagcaacagggcacaccctgtgagcaacgccgttgacggcacggag
cgctggtggcagagcccaccgctgtcgcgtgggctggagtacaacgaggtcaacgtcacc
ctggacctgggccaggttttccacgtggcctacgtgcttatcaagtttgccaactcacct
cggccagacctctgggtgctggaacggtccacggacttcggccacacctaccagccatgg
cagtatttcgcctcctccaagagggactgcctggagcggttcgggccacggacgctggag
cgcatctccggggacgacgacgtcatctgcagcaccgagtattcgcggatcgtgcccctg
gagaatggcgagatcgtggtgtccctggtgaacgggcgcccaggggccatgaacttctcc
tactcaccgctgctgcgtgatttcaccaaagccaccaacatccgcctgcgcttcctgcgc
accaacacgctgctgggccacctcatgggcaaggcactgcgggaccccacagtcacccgc
aggtactattacagcatcaaggacatcagcatcggcggccgctgtgtctgccacgggcac
gcggatgtgtgcgacgctcaagatcccacagaccccttcaggctgcagtgcgcttgccag
cacaacacgtgtgggagctcctgtgaccgctgctgccctggcttcaaccagcagccatgg
aagccggcaaccacggacagcgccaacgagtgccagtcctgcaactgccatggccacgcc
cacgactgctactacgaccctgaggtggaccggagcaacgccagccagaaccaggaccgc
gtctaccggggcgggggcgtgtgcatcgattgccagcatcacaccagcggcatcaactgt
gagcagtgcctacccggcttctaccgctccccagaccacccgctcgactcaccccatgcc
tgccgccgctgtgactgcgagtcggacttcacggacgggacgtgcgaggacctgacgggc
cgctgctactgccggccgaacttcacgggggcgcgatgcgatgcgtgtgccgaaggcttc
agcggcttcccgagctgccacccggtgccgtccttctctcacaatgacacgggggagcag
gtgctgccggccggccagattgtgcactgtgactgcagcgccgctgggacccagggcaac
gcctgccggaaggacccacgggtggggcgctgcgtgtgcaaacccaacttccagggcacg
cactgtgagctctgtgccccgggcttctacggcccgggctgccagccctgccagtgctcc
agccccggtgtggtggacggaacctgtgaccgcgactcgggccagtgcacgtgccgggca
ggattcgagggggcggcgtgcgaccgctgtgcccctggctacttccacttccccctctgc
cagctgtgcggctgcagccccacagggaccctgcccgagggctgcgatgacgctggccgc
tgcccttgccgacccgagtttgacggcccccactgtgaccgctgccgcccgggccaccac
agctaccccgagtgccacgcctgcgcctgcgacccccggggtgccctggaccagctgtgt
ggggcaggcggggtgtgccgctgccaccccagctacgcgggtgccacctgccaggagtgc
agcccaggcttccacggcttccccgactgtgccccctgccactgctcccccgaaggctcc
ctgcacacagcctgcgacccccacagcgggcagtgcagctgccgaccccgagtgacgggg
ctgcgctgtgacatgtgtgtgcctggtgcctacaatttcccctattgcgaagctggctcc
tgccaccctgctggcctggccccagccgatcatgatcttcctgaggtgcacatcccctgt
aggtgccgggctcacgtggaggggccaagttgcgatcgctgtaaacctgggttctggggg
ctgagtcctagcaaccctgagggctgcacccgctgcagctgtgaccccaggggcacactg
ggtggagttgctgagtgccagccgggcaacggccagtgcttctgcaagccccatgtatgc
ggccacacctgcgcggcctgcaaggacggcttcttcgggctggaccaggctgactacttc
ggctgccgtggctgccagtgcgacgttggcggagctctaggacagggctgtgagccgagg
acaggcgcctgcctgtgccgccccagcacccagggccccacctgcagcaagccagcgcag
gaccactaccttcccgacctgcaccagctgcgcctggagctggaggaggcggccacgccc
gagggccacgccgtgcgcttcggcttcaaccctctcgagtttgagagcttcagttggagg
ggctacgcgcagatggcacccatccagcccaggatcgtggcaaggctgagcgtggcctcc
cctgacctcttccgactggtcttccgctacgtcaaccgcgggcccgcgagcgtgagcggg
cgggtctccgtgcacgaccagggcaagtttgccacctgcgccaactgcgcagagcagagc
cagcccgtggctttcccgcccagcacggagcctgccttcgtcaccgtgccccagaggggc
ttcggggagcccttcgtgttgaaccccggcgcctgggccctgctcgtggaggccgagggg
gtgctcctggactacgtggctctgctgcccagcgcctactacgaggcggccctcctgcag
ctgcgggtgaccgagccctgcacgttccagcccgacgcgcagcgctccggggaccactgc
ctcctctacacccacctgcccctggacggcttcccctccgccactgggcctgaggccctg
tgtcgccacggcaacagcttaccccggccctgccccacggagcagctcagccccacccac
ccgctgctggtcgcctgccagggcgcagatgtggacgtccagcttcaggtggcggtgacg
cagccaggcccctatgccctggtggtggagtatgccaatgaggacgcccgccaggaggtg
gacgtagctgtgcacaccccccagcgggccccccagcagggggcgctcaccctccacccc
tgcccatacagcaccctgtgcaggggcaccgccctggatgcccagcgccatctggcggtc
ttccacctggacacggaggccagcgtccggctcacagccgagcatgcacgattcttcctg
cacagtgccaccctggtgcccgcagagaccttcagctcagagttcgtggagccccgcgtc
cgctgcattagcagtcacggcgccttcagccccagcagtgccgcctgcctgccctcccgc
ttcccgaagccgccgcagcctgtggtgctcagggactgccaggtgctgccgctgccgccc
ggcctcccgctgacccactctcgggagctcacgccgggcgcgcccccgcccgggccccag
ccccggcccccaaccgctgcggaccccgacgtggagcctaccctgcttcgccacccccag
ggcaccgtggtcttcaccacccacgtgcccgccctgggccgctacgccttcctgctgcac
ggctaccagccggcccaccccaccttcgctgtggaggttctcatcaacgggggtcgtgtc
tggcagggccatgccaacgccagcttctgcccgcacgcctacggctgccgcaccctggtg
gtgtgtgagggccgggccgtcctggatgtgaccgacagtgggctcactgtgaccgtgcgt
gtgcccgagggccgctggctctggctggagtatgtgctggtggtccccgaagatgcctac
agccccagctacttccgggaggagcccctggacaaatcctacgacttcatcagccagtgc
gccacccacggttaccacgtcagctcctccagctcgtcgtccttctgccgcaacgccgcc
acctccctctccctcttctataacaacggggctcggccgtgcagctgccatgaggtgggc
gccgtgggacccacgtgtgagcccttcgggggccagtgtccctgccgcgcccacgtcata
ggccgtgactgctcccgctgtgccactggctactggggcttccccagctgcaggccctgt
gactgcagcggccgcctctgtgatgagctcacaggccagtgcatctgcccgccgcgcacc
gtcccacccgactgcgtcatctgccagccgcagacctttggctgccaccccctggtcggc
tgtgaggagtgtaactgctcggggcccggcgtccaggaactcatggaccccacctgtgat
gtggacagtggccagtgcaagtgcagacccaacgtggccggacgccgctgtgacacttgt
gctcccgggttccacggcttccccagctgccgcccctgcgactgccatgaagcaggctct
gcacctggaacatgcgaccccctgacaggccagtgctcttgcaaggagaacgtgcagggc
ccgcggtgtgaccagtgccgccttgggacattctccctggacgttgccaacccgaaaggc
tgcacccgctgcttctgcttcggggccacggatcgctgccggagctccgcctacgcccgc
cgggagttcgtggacatggagggctggacgctgctgagtggtgaccggcaggtggtgccc
cacgagcggcaggcggaggcaacactgcttcgcgcggacctgcggcgcgtgcctgaggcc
ttccccgagctgtactggcaggccccgccctcctacctgggggaccgggtgtcatcctac
ggcgggaccctccactacgaactgcactcggagacccagcggggagacgtgttcatcccc
acggagagcagaccagacgtggtgctgcagggcaaccagatgagcatcgcgttcctggag
ccagtatacccggcacccggccacgttcaccgcggggagctgcagctggtggagggcaat
ttctggcacatggagacgcgcagcgccgtgtcccgcgaggagctcatgatggtgctggcc
ggcctggagcagctgcacatccgcgccctcttctcgcagacctcctcggccatctccctg
cgcagggtggcgctggaggtggccagcgaggtgggcgggggacctccggccagcaacgtg
gagctgtgcatgtgccctgccaactaccgcggggactcgtgccaggaatgcgcccctggc
tactaccgggacgtcaaaggtctctttttgggtcgctgcatcccctgtcagtgccatggc
cactcagaccgttgcctccctggctcgggtatctgtgtgggctgccagcacgacaccgag
ggcgaccactgcgagcgctgccaggccggcttcgtgcgcagcggacctgaggaccctgcg
gccccctgcatcagctgcccttgccctctggctgtgccttccaacaacttcgccacgggc
tgcatcctgcgaggtggccgtgcccagtgtctctgcaaacccggctatgctggggcctcc
tgcgagcggtgcgcacccggcttctttgggaaccccctggtgctgggcagctcgtgccag
ccctgcgactgcagcggcaacggcgaccccaacatgctcttcagcgactgcgaccccctg
acgggcgcctgccgcggctgcctgcgccacaccaccgggccccgctgcgagagctgcgcc
cccggcttctacggcaacgccctgctgcccggcaactgcacccggtgtgactgctccccg
tgtgggacggaggcctgtgacccccatagtgggcattgcctgtgcaaagcgggtgtgact
ggtcagcgctgcgaccactgtcaggaaggacacttcggctttgagggctgcgggggctgc
cgcccatgcgcctgtggaccagctgccgagggctccgagtgccacccccagagtgggcag
tgccactgccggccagggactgggggtctccagtgccgcgagtgtgcccccggccactgg
gggctccctgagcagggctgcaggcgctgccagtgccagggcggccactgtgacgtccac
acgggccgctgcacgtgcccccaggggctcagtggggagcgctgtgacacctgcagccac
cagcaccaggtgcccatgccaggagggcctgggggccacggcgtgcactgcgaagtgtgc
gaccactgtgtggtgttgctcctggacgacctggagcgggctggcgctctcctccccgcc
atccgggagcagctgcgtggcgtcaatgccagctccgtggtctgggcccggctgcacagg
ctgaacgcctccatcgccgacctgcagagccagctccggaaaccccctggcccccgtcat
gagactgcacagcagctggaggcactggaacgacagacctcaagcctcgggcaggacgtg
cagcagctggacggccaggctacaggggcccgagcccaggccggccagcttctggacagc
accgaggccacgctgggccgggcacagacgctgctggcagccgtccgggctgtggaccgc
gccctgagcgagctcgagtcccagacggaccgcctgtcaccagccaacgcctcagcccta
tcgggtgagcagctgcgccggacactggccgaggtggaacggctgctctgggagatgcgg
gcccgtgacttgggggttccgcgagccgccgcggaagctgagctgggggaggcccagaga
ctgctggcccatgtgcaggagcagctgaccaggcgctgggagaggaaccaggcgctggta
gcacgcatccgagaccagctggcccagcatgaggccggactcatggacctgcgggaagcc
ctgaacagggcggtgggcactacacgggaggcggaggagctcaacagccgcaaccaggag
cggctggaggaagccctgcaacgggaacaggagctgttccgggacaacgccactctgggg
gccactctgcaggccgccagagacaccctggtccggctcactgagcttctgcgcggcatg
gaccaggccaaggaggagtacgagcaccttgctgccagcctggatggggcccagacgccc
ctgctcgagaagatgcgggccttctccccggcgagcagcaaggtggacctggtggaggcc
gccgaggcccacgcctggcagctggatcagctggcgctcaacctttccagcatcatccag
ggagtcaaccaggaccgcttcatccagcgggccgtcgaggccgccaacgcctacagcagc
attctgcaagccgtgcgggccgccgagggtgccgccggccaggcacagcagcaggcgagc
cgtatatgggcggtagtcgtgcagcggggcctggcgtcccgagcccgggagctgctggcg
gacagcagtgccctggaggaggctgtccttggggagcagcggaggctgggcctcgcgtgg
gccaccctccagggcaccgggacccggctccgcgatgcccgggccaggaaggaacagctg
gcggcccgactccgggaggtgcaggccatgctggctatggacacagacgagacaagcaag
aagatagcccatgccaaggccgtggtcaccgaagcccaggacacggccgcccgcgtgcag
tcccggcttcaagacatgcagaaaaacgtggagcggtggcagggccagtacaagggcctg
cagagccaggacctgggccgggtggtgctcgacgcaggccgctcagtgtccaccctggag
aagacactgccgcagctgctggccaagctgagcctcctgcagaaccgtgggacgcacaac
gccagcctggccctgtcggccagcatcggccgcgtgcgggagctcattgcccaggcccgg
ggtgctgctgataaggtcaaggtgcccatgaagttcaacggtagctcaggggtgcagctg
cgcacccctcgggacctcgccagcctcgcctcttacacggccctcaagttctacctgcag
agcccagagccgctgcccggccaggtcgccggggaccagtttgtgctgtacatgggcagc
cgccaggccaccggcgactacatgggtgtggctctgcgtggccagaaggtgcactgggtg
taccgcctcgggggggcaggccccacggccctcagcatcgacgaggacatcggggaagag
ttcgcagccgtcagcattgacaggacgctccagtttggccatatgtctgtcacagtggag
aatcagatggtccaagagaccaagggtgatacggtggcccctggggccgaagggctgctc
agtgtgcagccggatgactttgtcttctacgtgggaggctaccctggcaacttcacgccc
cccgaacccctgcgctttcctggctaccggggctgcatcgagctggacacgctgaacgaa
gaggtggtcagtctctacaacttcgagaagaccttccagctggacacagccgtggataag
ccttgtgcgcgctccaagtcgaccggggacccgtggctcacggacggttcctacctggac
ggctctggcttcgcccgcatcagtgtggagagccagctgagcaacaccaaacgcttcgag
caggagctgcggcttgtgtcctacagtgggatcctcttcttcctgcggcaccaggaccag
ttcctgtgcctggccgtgcgggaaggcagcctcgtgttcctctacgactttggcatgggc
ctgaaggaggccgacccgctgcagcgcccgccgcctctgaccacgaccagcaaggcgatc
caagtgttcttgctggggggcagccggaagcgcgtgctggtgcgcgtggagaggaccacg
gtatttagcgtggagcaggacagcacgctggagctggctgacgcctactatctggggggc
gtgccacccagccagctgcccccgagcctgcggcggctctttccctccggaggctcggtg
cgcggctgcatcaagggcatcaaagctctgggcaagtacgtggatctgaagaggctgaac
acgacgggcatcagctccggctgcaccgctgacctgctggtgggacgggccatgactttc
cacggccacggctatctgcgcctggcgctccccagcaacgccgtgcccctcacgggcaac
gtctactccggcttcggcttccgcagcagccaggacagcgctctgctcttccaccgagag
tccccgaccgggccatgcgaggtgtccctgcagcagggccacgtgaccctccggcttgca
aggaccgaggtgaaaacgcgacgaggctttgccgacggggccccccactatgtcactttc
tacagcaacgccacgggggtctggctctacgtggacgaccagcttcaggagatgaggccc
caccgggagccgaggccccggccccagccccagcctgaggggtcgagtcagctcttcctg
gggggcttgcccaagtctgacgccctccgtaacttcagtggctgcataagcaacgttttc
gtgctgcggctcctggggccgcagcgcgtgtttgacctgcagcagaacctggagggtatc
aacgtgagctcaggctgcgtcccggcccctcgcacccaggcgccagatcagagcccgcga
ggactgcgggccacgaaggcctcccgccgcagccggcagcccgcccaggacacttcctgc
tcaccaccctggccccgcagggccatacgagacgcctaccagtttgggggtcccctgtcc
agtcacctggagtttgcacacgtcccgccccccaccagtgactggtcgcagctctccatg
ctcatccgcccgcacgccccccgagggctcttgctgttcgctgcccccctgacggccagc
agcccttccctagtcctcttcctgagccacggacgctttgtcgctcagacggaaggccct
gggccccagctccgagtccagagccgccagcgttcacggactggccggtggcacacagtg
tccgtgcgttgggagaagactcggatccagctggtgacggacggggtctgggcccagagc
cgggaggggccgggccggcggcaccagggggaggaaggcccccggccacacactctcttt
gtggggggcctccccgctggcggccacagcccacagctcccggtggccatcagccgctcc
gggttcagtggttgtgtgaagagactgaggttggacggccaactcctgggggctcccact
cgggtggtgggggccacaccctgcttctccggtcccctggagaagggcctgttctttgca
ggcagcgggggagccatcactctagacaccctgggggccacactgcctgacctgggcctg
gagctggaggtgcggccccagacagccaccggcctcgtcttccacttgggtcggggccca
gcgcccccctacctggagctgcgggtgctggggaggcaggtcctgctgcgggcagatgac
ggttcaggcgagttctccacactggtgacgctccccgaggcactgtgtgatgggcagtgg
caccgcctagcggtgaccaaaggtgggaacaggctccggctggaggtggacctgcagagc
aaccacaccctgggccccgcgccggccgccccggctgatgccccagtgccgctgtacctc
gggggcctgcctgaaccctggacgcggcctccaacctaccgcggctgcatgcggaatctg
gtggtgaaccaggccctggtctcctggcctcgtgctgcgggcgtgcagggggcagtgggg
gccagcggctgcccagccacgtag

DBGET integrated database retrieval system