KEGG   Delphinapterus leucas (beluga whale): 111163085
Entry
111163085         CDS       T05885                                 

Gene name
PTPN2
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X1
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163085 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111163085 (PTPN2)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111163085 (PTPN2)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111163085 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc
Other DBs
NCBI-GeneID: 111163085
NCBI-ProteinID: XP_022407250
UniProt: A0A2Y9LC65
LinkDB
Position
Unknown
AA seq 419 aa
MRGSSCALPGSCGARASPPAQAPSRQLTAAAMSAAIEREFDELDAQNRWQQLYLEIRSES
HDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINASLVDIEEAQRSYILTQGP
LPNTGCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTKDDREMLFKETGFSVKFLSE
DVKSYYTVHLLQLGNTNSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPE
HGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDNINIKQLLLNMRKYRMGLIQTPDQLRFS
YMTIIEGAKFIKGDSSIQKRWKELSKEDVCPVFDHSLNKIMTEKYNGNRIGLEEEKLTSD
RYTGLSSKMQDTLEENSESALRKRLREDRKASTAQKVQQMKQRLNESERKRKRPRLTDT
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcgcggcagcagctgcgcgctgcccggatcgtgcggggcccgagcctctccgccggcg
caggctccctcgcgccagctcacggccgccgccatgtcggccgccatcgagcgggagttt
gatgagttggacgctcagaatcgctggcagcagctgtacctggaaattcgcagtgagtcc
catgactatcctcatagagtggccaagtttccagaaaacagaaatcgaaacagatacaga
gatgtaagcccatatgatcacagtcgtgttaaactgcaaaatgctgaaaatgattatatt
aatgccagcttagttgacatagaagaggcgcagaggagttacatcttaacacagggtcca
cttcctaatacaggttgtcatttctggctcatggtttggcagcaaaagaccaaagcagtt
gtcatgctaaaccgaattgtggagaaagaatcggttaaatgtgcacagtactggccgaca
aaggatgaccgagagatgctgtttaaggaaacaggcttcagtgtgaagttcctgtcggaa
gacgtgaagtcctattatacagtccatctgctgcagttaggaaacaccaatagtggtgaa
accagaacaatatctcactttcattatactacctggccagatttcggagtccctgaatca
ccagcttcatttctcaatttcttatttaaagtgcgagagtctggctctttgaatcctgaa
cacgggcctgcagtgatccactgtagtgccggcatcgggcggtcaggcaccttttctctg
gtggacacttgtcttgttctgatggaaaaaggagacaatattaatattaaacaactgtta
ctgaatatgagaaaataccgaatggggctgattcagacaccagatcaactcagattttca
tacatgactataatagaaggagcaaagtttataaagggagattcaagtatacagaaacgg
tggaaagaactttctaaggaagatgtatgtcctgttttcgatcattcactaaacaaaata
atgactgaaaaatacaacggaaacaggataggcctagaagaagaaaaactgacaagtgac
aggtatacaggactgtcctctaaaatgcaagatactctggaggaaaacagcgagagtgct
ctgcgcaagcgccttcgggaggacaggaaagccagcacagctcagaaggtgcagcagatg
aagcagaggctgaacgagagcgaacgaaaaaggaaaaggccaagattgacagacacctaa

DBGET integrated database retrieval system