KEGG   Delphinapterus leucas (beluga whale): 111163101
Entry
111163101         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163101
   04151 PI3K-Akt signaling pathway
    111163101
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163101
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163101
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163101
   04621 NOD-like receptor signaling pathway
    111163101
   04622 RIG-I-like receptor signaling pathway
    111163101
   04623 Cytosolic DNA-sensing pathway
    111163101
   04650 Natural killer cell mediated cytotoxicity
    111163101
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163101
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111163101
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111163101
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111163101
   05161 Hepatitis B
    111163101
   05160 Hepatitis C
    111163101
   05171 Coronavirus disease - COVID-19
    111163101
   05164 Influenza A
    111163101
   05162 Measles
    111163101
   05168 Herpes simplex virus 1 infection
    111163101
   05163 Human cytomegalovirus infection
    111163101
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163101
   05169 Epstein-Barr virus infection
    111163101
   05165 Human papillomavirus infection
    111163101
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163101
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163101
SSDB
Motif
Pfam: Interferon LMF1
Other DBs
NCBI-GeneID: 111163101
NCBI-ProteinID: XP_030619671
LinkDB
Position
Unknown
AA seq 171 aa
MAQIYLLVAGVILCSIPARPLGWNLPWIHSLQNRELFILLRQMKKIPFQSCLEDRTDFKF
PWKTGNITEILTTQGTGYHHLTLQQMXNFFSKEESQAAWNNTLLHKLLSSLDHTLELLHE
QVENDNLDCPYLGIVVPKYFQRIHLYLKEKEYXPCAWEVIRGEIKVFLSLM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagatctatttgctagtggcaggagtgatactctgctccatccctgctcgccct
cttggctggaatttgccttggatccatagcctacagaacagggaactcttcatacttctg
agacagatgaagaagatcccgtttcagtcatgcctagaggacagaaccgacttcaaattt
ccttggaaaacagggaatatcacagaaatcctgacgactcaaggcaccggctaccaccat
ctgacgctccagcagatgngtaacttcttcagcaaggaggaaagccaagctgcttggaac
aacaccctactccataaactactctctagccttgatcacaccttggaactactgcatgag
caagtggaaaatgacaatctggactgtccatatttgggaattgttgtccctaaatatttc
caaagaatccatctctatctgaaggaaaaggaatacnacccctgtgcctgggaggttatc
agaggagaaattaaagtgttcctttctctcatgtaa

KEGG   Delphinapterus leucas (beluga whale): 111163130
Entry
111163130         CDS       T05885                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163130
   04151 PI3K-Akt signaling pathway
    111163130
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163130
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163130
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163130
   04621 NOD-like receptor signaling pathway
    111163130
   04622 RIG-I-like receptor signaling pathway
    111163130
   04623 Cytosolic DNA-sensing pathway
    111163130
   04650 Natural killer cell mediated cytotoxicity
    111163130
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163130
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111163130
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111163130
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111163130
   05161 Hepatitis B
    111163130
   05160 Hepatitis C
    111163130
   05171 Coronavirus disease - COVID-19
    111163130
   05164 Influenza A
    111163130
   05162 Measles
    111163130
   05168 Herpes simplex virus 1 infection
    111163130
   05163 Human cytomegalovirus infection
    111163130
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163130
   05169 Epstein-Barr virus infection
    111163130
   05165 Human papillomavirus infection
    111163130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163130
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111163130
SSDB
Motif
Pfam: Interferon CBF CoV_NSP2_N
Other DBs
NCBI-GeneID: 111163130
NCBI-ProteinID: XP_022407318
UniProt: A0A2Y9LPV7
LinkDB
Position
Unknown
AA seq 226 aa
MGSHLRPRPEGRSSENLESRVHRVPTSARPAASAGSPMAPTLSLLLALVLLSCNSNCSLG
CDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFGFPLEAFGGNQFQKAQAIAVVHEM
IQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQACLMQEAGLEGTPLLKEDSILAV
RKYFHRVTVYLQEKKYSPCAWETVRAEVMRSFSSSTNLQERLRRKE
NT seq 681 nt   +upstreamnt  +downstreamnt
atgggttcccatttaagacccaggcctgaaggaaggtcttcagagaacctagagagcagg
gttcacagagtccccacctctgccaggccggcagcatctgcagggtccccgatggcccca
accttgtctttactcctggccctggtgctgctcagctgcaactccaactgctctctgggc
tgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctcctgcaacaa
atgaggagaatctcccccttctcctgcctgaaggacagaaatgactttggattccccctg
gaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtccatgagatg
atccagcagaccttccagctcttcagcacagagggctcggctgccgcttgggatgagacc
ctcctggacaagttctgcactgcactttatcagcagctcactgacctgcaagcctgtctg
atgcaggaggcggggctggaagggactcccctgctgaaggaggactccatcctggctgtg
aggaaatacttccacagagtcactgtctatctgcaagagaagaaatacagcccttgtgcc
tgggagactgtcagagcagaagtcatgagatccttctcttcatcaacaaacttgcaagaa
agactcagaaggaaggaatga

KEGG   Delphinapterus leucas (beluga whale): 111171121
Entry
111171121         CDS       T05885                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111171121
   04151 PI3K-Akt signaling pathway
    111171121
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111171121
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111171121
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111171121
   04621 NOD-like receptor signaling pathway
    111171121
   04622 RIG-I-like receptor signaling pathway
    111171121
   04623 Cytosolic DNA-sensing pathway
    111171121
   04650 Natural killer cell mediated cytotoxicity
    111171121
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171121
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111171121
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111171121
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111171121
   05161 Hepatitis B
    111171121
   05160 Hepatitis C
    111171121
   05171 Coronavirus disease - COVID-19
    111171121
   05164 Influenza A
    111171121
   05162 Measles
    111171121
   05168 Herpes simplex virus 1 infection
    111171121
   05163 Human cytomegalovirus infection
    111171121
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171121
   05169 Epstein-Barr virus infection
    111171121
   05165 Human papillomavirus infection
    111171121
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111171121
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111171121
SSDB
Motif
Pfam: Interferon CBF CoV_NSP2_N
Other DBs
NCBI-GeneID: 111171121
NCBI-ProteinID: XP_022422467
UniProt: A0A2Y9MTZ8
LinkDB
Position
Unknown
AA seq 133 aa
MTLDSPQEAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQL
TELQACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQENKYSPCAWETVRAEVMRSFS
SSTNLQERLRRKE
NT seq 402 nt   +upstreamnt  +downstreamnt
atgactttggattccccccaggaggcgtttggaggcaaccagttccagaaggctcaagcc
atcgctgtcgtccatgagatgatccagcagaccttccagctcttcagcacagagggctcg
gctgccgcttgggatgagaccctcctggacaagttctgcactgcactttatcagcagctc
actgaactgcaagcctgtctgatgcaggaggcggggctggaagggactcccctgctgaag
gaggactccatcctggctgtgaggaaatacttccacagaatcactgtctatctgcaagag
aacaaatacagcccttgtgcctgggagactgtcagagcagaagtcatgagatccttctct
tcatcaacaaacttgcaagaaagactcaggaggaaggaatga

KEGG   Delphinapterus leucas (beluga whale): 111171122
Entry
111171122         CDS       T05885                                 

Definition
(RefSeq) interferon alpha-1-like isoform X1
  KO
K05414  interferon alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111171122
   04151 PI3K-Akt signaling pathway
    111171122
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111171122
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111171122
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111171122
   04621 NOD-like receptor signaling pathway
    111171122
   04622 RIG-I-like receptor signaling pathway
    111171122
   04623 Cytosolic DNA-sensing pathway
    111171122
   04650 Natural killer cell mediated cytotoxicity
    111171122
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171122
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111171122
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111171122
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111171122
   05161 Hepatitis B
    111171122
   05160 Hepatitis C
    111171122
   05171 Coronavirus disease - COVID-19
    111171122
   05164 Influenza A
    111171122
   05162 Measles
    111171122
   05168 Herpes simplex virus 1 infection
    111171122
   05163 Human cytomegalovirus infection
    111171122
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171122
   05169 Epstein-Barr virus infection
    111171122
   05165 Human papillomavirus infection
    111171122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111171122
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111171122
SSDB
Motif
Pfam: Interferon CBF CoV_NSP2_N
Other DBs
NCBI-GeneID: 111171122
NCBI-ProteinID: XP_022422468
UniProt: A0A2Y9MZC7
LinkDB
Position
Unknown
AA seq 195 aa
MGPTLSLLLALVLLSCNSNCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG
FPPGGVWRQPAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQ
QLTDLQACLMQEAGLEGTPLLKEDSILAVRKYFHRVTVYLQEKKYSPCAWETVRAEVMRS
FSSSTNLQERLRRKE
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggcccaaccttgtctttactcctggccctggtgctgctcagctgcaactccaactgc
tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc
ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga
ttccccccaggaggcgtttggaggcaaccagcgtttggtggcaaccagttccagaaggct
caagccatcgctgtcgtccatgagatgatccagcagaccttccagctcttcagcacagag
ggctcggctgccgcttgggatgagaccctcctggacaagttctgcactgcactttatcag
cagctcactgacctgcaagcctgtctgatgcaggaggcggggctggaagggactcccctg
ctgaaggaggactccatcctggctgtgaggaaatacttccacagagtcactgtctatctg
caagagaagaaatacagcccttgtgcctgggagactgtcagagcagaagtcatgagatcc
ttctcttcatcaacaaacttgcaagaaagactcagaaggaaggaatga

KEGG   Delphinapterus leucas (beluga whale): 111174560
Entry
111174560         CDS       T05885                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04668  TNF signaling pathway
dle05135  Yersinia infection
dle05142  Chagas disease
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111174560 (IFNB1)
   04668 TNF signaling pathway
    111174560 (IFNB1)
   04151 PI3K-Akt signaling pathway
    111174560 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111174560 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111174560 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111174560 (IFNB1)
   04621 NOD-like receptor signaling pathway
    111174560 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    111174560 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    111174560 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    111174560 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111174560 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111174560 (IFNB1)
   05152 Tuberculosis
    111174560 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111174560 (IFNB1)
   05161 Hepatitis B
    111174560 (IFNB1)
   05160 Hepatitis C
    111174560 (IFNB1)
   05171 Coronavirus disease - COVID-19
    111174560 (IFNB1)
   05164 Influenza A
    111174560 (IFNB1)
   05162 Measles
    111174560 (IFNB1)
   05168 Herpes simplex virus 1 infection
    111174560 (IFNB1)
   05163 Human cytomegalovirus infection
    111174560 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174560 (IFNB1)
   05169 Epstein-Barr virus infection
    111174560 (IFNB1)
   05165 Human papillomavirus infection
    111174560 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111174560 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111174560 (IFNB1)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interferons
   111174560 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111174560
NCBI-ProteinID: XP_022429154
UniProt: A0A2Y9N397
LinkDB
Position
Unknown
AA seq 185 aa
MTHRCILQIALLLCFSTTALSTSYRLLQFQQRSSNLACQKLLQQLPGMPQHCLEDRMDFK
VPEEIKQPQQFQKEDAVLVIYEMLQQIFGILRRNFSSTGWTKTITENLLVEVYGQMDRLE
NILEEIMEKENFTRGVNILHLKKYYLQIVQYLKSKEYSNCAWTVVRVEILRNFSFLNRLT
DYLHN
NT seq 558 nt   +upstreamnt  +downstreamnt
atgacccacaggtgcatcctccaaatcgctctcctgttgtgcttctccaccacagctctt
tccacgagctacagattgcttcaattccaacaaaggagcagcaatttggcgtgtcagaaa
ctcctgcagcagttacctggaatgcctcaacattgcctcgaggacaggatggacttcaag
gtccctgaggagattaagcaaccacagcagttccagaaggaagacgccgtattggtcatc
tatgagatgctccagcagatctttggtattctcagaagaaatttctctagcaccggctgg
actaagaccatcactgagaacctccttgtggaagtctatgggcagatggatcgtctggag
aatatcctggaggaaataatggagaaggaaaacttcaccaggggagtgaacattcttcac
ctgaagaaatactacttgcagatcgtgcagtacctgaagtccaaggagtacagcaactgt
gcctggacagtagtgcgagtggaaatcctcaggaacttttccttccttaaccgccttaca
gattacctccataattga

DBGET integrated database retrieval system