KEGG   Delphinapterus leucas (beluga whale): 111163128
Entry
111163128         CDS       T05885                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha isoform X1
  KO
K05059  ciliary neurotrophic factor receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163128 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163128 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163128 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
    111163128 (CNTFR)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111163128 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
 Receptors
  111163128 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 111163128
NCBI-ProteinID: XP_022407315
UniProt: A0A2Y9LCD6
LinkDB
Position
Unknown
AA seq 374 aa
MAVPVPWACCAVLAAAAAVVYAQRHSPHETPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLNVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTVKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTASTTSSLAPPPTTKICDPGELGSGGGPSAPFFISVLVTLAL
AAAAAAAAASSLLI
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggctgttcctgtcccatgggcctgctgtgccgtgcttgctgctgccgctgccgtggtc
tacgcccagagacacagtccacatgagacaccccacgtgcagtacgaacgcctgggctca
gacgtgactctgccgtgtgggacggcgaactgggatgcagctgtgacgtggcgggtgaat
gggacagacctggcccctgacctgctcaatggctctcagctcgtgctccgtggcctggaa
ctgggccacagcggcctctacgcctgcttccaccgcgactcctggcacctgcgccaccaa
gtcctcctaaatgtgggcttgccgccgcgggagcccgtactcagctgccgctccaacact
tatcccaagggcttctactgcagctggcatctgcccactcccacctacatccccaacacc
ttcaatgtgactgtgctgcatggctccaagattatggtctgtgagaaggacccggccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccgtcaagtacaaggtctcg
ataagtgtcagcaacgctctgggccacaacgccacagctatcaccttcgatgagttcacc
attgtgaagcctgaccctccagaaaacgtggtagcccggccagtgcccagcaaccctcgc
cggctagaggtgacatggcagaccccctcgacctggcctgaccccgagtcctttcctctc
aagttctttctgcgctatcgacccctcatcctggaccagtggcagcatgtggagctgtcg
gatggcacagcgcacaccatcacggatgcctacgctggaaaggagtacatcatccaggtg
gccgccaaggacaatgagattgggacgtggagtgactggagtgtggccgcccacgccaca
ccctggactgaggagccacgacacctcaccaccgaggcccaggcccccgagaccacggcc
agcaccacaagctccctggcacccccgcctaccacgaagatctgtgaccccggcgagctg
ggcagcggcggaggaccctcggcgcccttcttcatcagtgtccttgtcaccctggccctg
gctgctgctgccgctgccgccgctgccagcagtctcctgatctga

KEGG   Delphinapterus leucas (beluga whale): 111163143
Entry
111163143         CDS       T05885                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X1
  KO
K05056  interleukin 11 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163143 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163143 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111163143 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163143 (IL11RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111163143 (IL11RA)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 111163143
NCBI-ProteinID: XP_022407346
UniProt: A0A2Y9LF57
LinkDB
Position
Unknown
AA seq 422 aa
MSSSCSGLSRVLVAVATALVSASCPCPQAWGPPGVQYGQPGRAMTLCCPGVTAGAPVSWF
RDRETRLLQGPDSGLGHELVLARAESTDEGTYICRTLDGALGGMVTLQLGYPPVRPVVSC
QAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCPQDPPGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGPLPKEIPAGGQQHAQPEEEPQAVSPAPPRPSLLPDPRPLDHR
DALEQVAMLASLGIFSFLGLVAGALALGLWLRLRPCEKDGPQKSGFLAPMIPVDKLPGVP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgttcagggctgagcagggtcctggtggccgtggctacagccctggtg
tctgcctcctgtccctgcccccaggcctggggccccccaggggtccagtatgggcagcct
ggcagggccatgacgctgtgttgccctggagtgactgctggggccccggtgtcctggttt
cgggaccgggagacaaggctgctccagggacctgactctggtctagggcacgaactggtc
ctggcccgggcagaaagcactgacgagggcacctatatctgccggaccctggatggtgca
cttgggggcatggtgaccctgcagctgggctaccccccagtccgccctgttgtctcctgc
caagcagctgactatgagaacttctcctgcacttggagtcccagccaggttagcggttta
cccacccgctacctcacctcctacaggaagaagacggtaccaggagccgatggccaaagg
atgagtccatccacagggccctggccatgcccacaggaccccccaggggctgcccgctgt
gtggtccatggggcagagttctggagccagtaccggatcaatgtgactgaagtgaacccc
ctgggggccagcacacgcctactggatgtgagcttgcagagcatcttgcgccctgatcca
ccccaggggctgcgggtagagtcagtacctggctatcctcgccgcctgcgtgccagctgg
acgtaccctgcctcctggccccgccagccccacttcctgctcaagttccggctgcagtac
cgtccagcacagcatccagcctggtccacggtggaaccggctggattggaggaggtgatc
acggacgctgtggctgggctgccccatgccgtgcgggtcagtgcccgggactttctggac
gcaggcacctggagcgcctggagccccgaggcctggggtactccgagcaccggaccccta
ccgaaggagataccagctgggggccagcaacacgcgcagccagaggaagaacctcaggcg
gttagccctgctcccccaagaccgtccctcctaccagacccgcggccacttgaccacaga
gacgccctggagcaggtggctatgctggcatctttgggaatattctctttcttgggactg
gtggctggggccctggcactggggctctggctgaggttgagaccatgtgagaaggatgga
ccccaaaagtctgggttcttggccccgatgattccggtggacaagcttccaggagtccca
aacctgtag

KEGG   Delphinapterus leucas (beluga whale): 111163318
Entry
111163318         CDS       T05885                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1 isoform X1
  KO
K05140  interferon lambda receptor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163318 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163318 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163318 (IFNLR1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111163318 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111163318
NCBI-ProteinID: XP_022407605
UniProt: A0A2Y9LD96
LinkDB
Position
Unknown
AA seq 535 aa
MTGAPRWASLLLCLLQSTSGRPLLAPPQNVTLLSWDFSVYLTWLPGPGNPQNMTYFVAYQ
RCSRLICTIPDLKPEISHVSICSATPKQWRRVKKCAGTKELQCSLMCLEKQDLCNKFKGR
VRAVSPRARSPWVESKSMDYFFEVEPAPPILVFTRTDEILSVNATYQLPHCMPQPDLSYE
VYFWKEGTGNEASFPATPHGQPVQISLQPDTSGHHCLSARTIYTFGSPKYSKFSEPTCFF
LEAPGSNWALLVLLPLLLPMLLVVATGPVIWKSFRGNPWFHQAKMPQALDLSGHRHPGAT
FQPSGPECLHVLILSPQKERTRRVRLTPGVRAPAAVQAGSEDSDEEEKGDEESTDDGASF
QPYTEPPPFLGQEHQSPGHAEAGGPWTPLVRVEGSSACDSSDGSWASTAGSSPWDEAGSS
GYLAKKRPGRGPGGKELQKPLPPPEFSEDSSSLEEPPEDNPSSWVSWGLPSPGLIPREPP
VSLQTLTFCWDSSPEEEEEGGGESEGEDSSDGSCGAKSLQRIEVRGRTLGHYLAR
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaccggggccccgcggtgggcctcgttgctcctgtgcctgctgcagtccacttcaggg
aggccccttctggcccctccccagaacgtgacgctgctctcctgggacttcagtgtgtac
ctgacgtggctcccaggacctggcaacccccagaacatgacctattttgtggcctatcaa
agatgttccagactcatttgcacaattcctgacctaaaacctgaaatcagccacgtctcc
atttgctctgcaacccccaaacagtggcggagagtaaaaaagtgcgcaggaaccaaagag
ctacagtgctctctgatgtgcctggagaaacaagacctgtgcaataagttcaaggggcgt
gtgcgagcagtttctcccagagccaggtcaccctgggtggagtccaagtccatggattac
ttttttgaagtggagccagccccacctatcctggtattcacccggacagacgagatcctg
agtgtcaatgccacataccagctgccccactgcatgccccaaccagatctgagctatgag
gtgtatttctggaaggaggggaccgggaatgaggccagttttccagccactccccatggc
cagccagtccagatttctctccaaccagacaccagtggacaccactgcctcagcgccaga
actatatacacctttggctcccctaaatacagcaagttctctgagcccacctgcttcttc
ctggaggccccaggatccaactgggcactcctggtactgctaccccttctgctgccaatg
ctgttggtcgttgccacggggcctgtgatctggaagagcttcagggggaacccctggttt
catcaggcaaagatgccacaggccctggacctctctggacacagacaccccggggcaacc
tttcaacccagtggcccagagtgcctgcacgtcttgatcctctctccccaaaaggaacgg
accagaagggtcaggctgacccctggagtcagggccccagccgccgtccaggcaggatca
gaggacagtgatgaggaggagaagggtgacgaggagagcacggacgatggtgccagcttc
cagccctacactgaaccaccccccttcctggggcaggaacaccagagcccggggcatgct
gaggcaggagggccttggactcctctggtccgggtcgaaggctcctctgcttgcgattct
tcagacggaagctgggccagcactgcgggctcctccccctgggacgaggctggatcatct
ggctacttggccaagaagaggccaggccgaggaccgggtgggaaggagctccagaagcct
ctcccaccacccgaattctccgaggactcgagttccctggaagagcccccagaagacaac
ccgtcctcctgggtcagctggggcttaccgtcaccagggctgattcccagggagccccca
gtttctcttcagacactgaccttctgctgggacagcagccccgaggaagaagaagagggt
gggggggaatcagaaggtgaggacagcagtgacggcagctgcggggctaagagcctccag
aggatcgaggtcagaggtaggacactgggacactacttggccaggtga

KEGG   Delphinapterus leucas (beluga whale): 111163429
Entry
111163429         CDS       T05885                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163429 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163429 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111163429 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163429 (IL22RA1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111163429 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111163429
NCBI-ProteinID: XP_022407806
UniProt: A0A2Y9LGE8
LinkDB
Position
Unknown
AA seq 581 aa
MRMLLVILAAGSLVAHFAEDTSDLLQHVKFQSSNFENILTWDSRPESAPDTVYSVQYKTY
GETEWQAKEGCQRITRKSCNLTMETGNLTDFYYARVTAIDAGGQSATKMTDRFSSLQHTI
IKPPDVTCIPKVRSIQLIVHPTYTPIHTGNGHRLTLEDIFQDLFYHLDLHINHTYQMHLG
GKQREFEFFGLTPDTEFLGTIVSLVPTWSKKSIPYMYRAKTLPDQTWTYSFSGAFLFSMG
FLVAGLCYLSYRYITKPPPPPNSLDVQHVLTFQPLQFIQEHILSPVFDLSGPSGLAQPVQ
YSQVKVSGPIEPPGAPPRHSLSEVAYLGRPDLSILRPSGGPPLQTLPPLPYAPQAAPEGG
PLSYAPQVTPQTKPPSYTPQAISEAQPPSYTPQATPDSWPPSYGICREGSGRDPPPMTLS
GPKHLGTKGQLQKEAPAGSCSPGGLSLQQVTSLAMEDPQEVKSFHQHLGVHTDREPDSDV
VRRGEPRTRSYVKGQLPLLSSVQIEGHPVSLPLQTPSRPCSPTDKGPSPWGLLESLVCPS
DEGPTTETEAQSPGPRAPDLESPMELDSLFRGLALTVQWET
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggatgctgctggtcatcctggcggcgggatccctagtcgctcacttcgctgaggac
acctcagatcttcttcagcacgtgaaattccagtccagcaacttcgaaaacatcctgacg
tgggacagcaggccggagagtgccccagacaccgtctacagtgtgcagtataagacttat
ggagagacagagtggcaggcaaaggagggctgccagcggatcacccggaaatcctgcaac
cttaccatggagacaggcaaccttacggatttctactacgcccgggtcactgccatcgac
gcaggaggccagtccgccactaagatgaccgaccggttcagctcactgcagcacactatc
atcaaaccacctgatgtgacttgtatccccaaggtgagatccatccagttgattgtccat
cccacctacacgcccatccacacagggaatggccaccggctaaccctggaggacatcttc
caggacctgttctatcacttagatctgcacatcaaccacacctaccaaatgcaccttgga
ggcaagcagagagaatttgagttctttggcctgacccctgacacagagttccttgggacc
atcgtgagtttagttccaacctggtccaagaagagcatcccctacatgtaccgagcgaag
acgctgccagatcagacgtggacctactccttttccggcgcattcctgttctccatgggc
ttcctggtcgcagggctctgctatctgagctacagatacatcaccaagccgcctccgcct
cccaactccctggatgtccagcacgtactgaccttccagcctctgcagttcatccaggag
cacatcttaagccccgtctttgacctcagtggcccgagcggcctggcgcagcctgtccag
tattcccaagtcaaggtctccgggcccatcgagcctccaggagccccaccgcgacacagc
ctgtctgaggtcgcctaccttgggcggccggacctctccatcctccggccctctggcggg
ccacctctccagacactccccccactgccctatgccccccaggctgcccctgagggcggg
cccctgtcctatgcacctcaggtaaccccccaaactaaacccccctcctacactccccag
gccatctcggaggcccagcctccttcctacacccctcaggccactccggacagctggcct
ccttcctacgggatatgcagggaaggctctggcagagaccccccacctatgacactctct
ggtcccaaacacctcggaactaaaggtcagctccagaaagaggcaccagctggaagctgc
agcccaggtggcctttctctgcagcaggtgacctccttggctatggaggacccccaagaa
gtaaaatccttccaccagcatctgggggttcacacggacagagaacctgactctgatgtc
gtacgcagaggagagccaaggacacgaagctacgtaaagggccagctgcccctcctctcc
tctgtccagatcgagggtcaccccgtgtccctccctttgcagactccttcccgcccatgt
tcccccacagacaagggtccgagtccctggggcttgctggagtccctcgtgtgtcccagt
gatgagggtccaacaaccgagactgaggcccagagcccaggccctcgggccccagacctg
gagtcgcccatggagctggactctctgttcagaggcctggccctgacggtacagtgggag
acctga

KEGG   Delphinapterus leucas (beluga whale): 111163780
Entry
111163780         CDS       T05885                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1 isoform X1
  KO
K05130  interferon receptor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163780 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    111163780 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163780 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163780 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163780 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    111163780 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    111163780 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111163780 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163780 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111163780 (IFNAR1)
   05160 Hepatitis C
    111163780 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    111163780 (IFNAR1)
   05164 Influenza A
    111163780 (IFNAR1)
   05162 Measles
    111163780 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    111163780 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163780 (IFNAR1)
   05169 Epstein-Barr virus infection
    111163780 (IFNAR1)
   05165 Human papillomavirus infection
    111163780 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163780 (IFNAR1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IFN receptor family
   111163780 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF4542
Other DBs
NCBI-GeneID: 111163780
NCBI-ProteinID: XP_022408505
UniProt: A0A2Y9LG18
LinkDB
Position
Unknown
AA seq 561 aa
MLALLGATTLMLVAGAPWVLPAASGGTNLKSPENGRVCIIDDNFILQWNSSRESVRNVTF
SAEYKIPGMENWKKLPGCQHITSTECNFSSVKLKNVYEKIELRIRAEKGNNTSQWHEVKP
FIPFQEAQIGPLDVHLEAEDKAIIINISPPGTKDSVMWAMDHSSFIYSLVIWKNSSSLEE
RTETVYSRDKIYKLSPETTYCLKVKAELRSPRRVGFYSPVYCINTTEKHKVPSPENIQID
AENQVYVLKWDYAHENTTFRAQWSHEFLKRIPGSHSDKWKQIPNCEDVETTHCVIPQNAF
PEGIHRIRVQASVGNNTSFWSEEKIFNTEMKTIIFPPVISMKSVNDDSLHVSIGAPKESE
NKSVNQLYPLIYEVIFWENTSNAERKVVEKRTDVTFPNLKPLTVYCVKAKALTENGKWNK
SSVFSATVCEKTKPGNTSKTWLIAGICTALFSIIVIIYVVKVLLRCINYVFFPSSKPPST
VDEYFSEQPVRNLLLSTSEEQTERCSIIENANTITVIEETNPIEDHKKYNSQTSQDSGNY
SNEDENSGSKISEELLEQETV
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgctcgcgctcctgggcgcgacgaccctgatgctggtcgctggggcgccgtgggtgttg
cccgcagcttcagggggaacaaatctaaaatctcctgaaaatggcagggtctgcatcatt
gatgacaactttatcctgcagtggaacagcagccgtgagtctgtcaggaatgtgactttt
tcagcagagtataaaataccaggaatggaaaattggaagaagttgcctgggtgtcagcat
attactagtaccgaatgcaacttttcttcagtcaagcttaaaaatgtttatgaaaaaatt
gaattgcgcataagagcagaaaaaggaaacaacacttctcaatggcatgaggttaagcca
tttataccatttcaagaagctcagattggtcctctagatgtacatttagaagctgaagat
aaggcaataataataaacatctctcctcctgggacaaaagatagtgtcatgtgggctatg
gatcattccagctttatatatagcttagttatctggaaaaactcttcaagtctagaagaa
aggactgaaactgtttattccagagataaaatttataaactctcaccagagactacttat
tgtttaaaagttaaagcagaactacgttcaccaagaagagttggtttctatagtccagtg
tattgtataaacaccacagagaaacacaaagtgccttcaccagaaaatatacaaatcgat
gctgaaaatcaggtctatgtccttaaatgggattacgcacatgaaaacacgacttttcga
gctcagtggtcccatgagtttttaaaaaggattcctgggagtcattcagacaaatggaaa
caaataccaaactgtgaagatgtcgaaactacccactgtgtgattcctcaaaatgctttc
ccagaaggaattcaccgtatccgtgtacaagcatctgttggaaataacacatctttttgg
tctgaagagaaaatatttaatactgaaatgaaaactatcatatttcctccagtcattagc
atgaaatccgttaatgatgactcactgcacgtctctatcggtgctccaaaagagtctgaa
aacaagtctgtgaaccagctttacccactaatttatgaagttattttttgggaaaacact
tcaaacgctgagagaaaagttgtagagaaaagaactgatgttacctttcctaacttgaaa
ccgctgactgtatactgtgtgaaagccaaagcactcactgagaatggcaagtggaataaa
agcagtgtttttagtgctactgtgtgtgagaaaacaaaaccaggaaatacttccaaaacc
tggcttatagctggaatttgcactgcgttattttctatcattgttatcatttatgttgtg
aaagtcctcttgagatgtatcaattatgtgttctttccatcaagtaaacctccttccact
gtagatgagtatttctctgaacagccagtaaggaatctactcctttccacttctgaggaa
caaacggaaagatgttctataattgaaaatgcaaacactattactgtaatagaagagact
aatccaattgaagatcacaaaaagtacaattcccaaactagtcaagattcaggaaactat
tctaatgaagacgaaaacagtggaagtaaaataagtgaagaacttctggaacaggaaact
gtgtga

KEGG   Delphinapterus leucas (beluga whale): 111163874
Entry
111163874         CDS       T05885                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X3
  KO
K05131  interferon receptor 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05160  Hepatitis C
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163874 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    111163874 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163874 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163874 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163874 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    111163874 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    111163874 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111163874 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163874 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111163874 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    111163874 (IFNAR2)
   05164 Influenza A
    111163874 (IFNAR2)
   05162 Measles
    111163874 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    111163874 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163874 (IFNAR2)
   05169 Epstein-Barr virus infection
    111163874 (IFNAR2)
   05165 Human papillomavirus infection
    111163874 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163874 (IFNAR2)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IFN receptor family
   111163874 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111163874
NCBI-ProteinID: XP_022408679
UniProt: A0A2Y9LG89
LinkDB
Position
Unknown
AA seq 594 aa
MVLSQNVSAVGPLNLYPMVSLCHLFHSLSVFMSWSLLPRQVPCIGEYMTALFPHLLKMPL
TRPPTRQVVVTSRKQMRIPTSHHQDLSSSTNPVHISLVFGISYVLPDFSDESCTLKMTLR
NLQSILSWELKNHSIVPTHYTLWYTIMSKQEDMKIVGDCTNITRSFCDLTDVWVNMTEMY
IPKVVGFRGNAALVSCVGSFFLAMDTLPLDPPEFEIVGFTDHISVNVKFQSVAPKILNEE
ELQFYLALIEEQSGGTVKKHKPQINGNVTENFIYVIDKLIPKTNYCVSVYFEPKHPRKIK
RSPLKCTLFQPGWESESSESATIGGIITLFLMAAVVISTVMMLKRIGYICLRNNSPKVLN
FYKLSVWVFPELPPLEKVATVEVIHINRKKKVWNYNYDDESDSDNEAAPRTSAGGYTTHG
LTGRLWPASVSSATLEDCSDPAAEERDLPDPEADAETLMAPGPSPWQSECTSRGYQGRGN
LLQDPFSEEDSSPTEGSGDRIVFNVDLNSVCVRALEDNDDSEVTPMLPSGPEETVVLEDP
DETESNLLLVASGEGTQLPFPGPSAQYPWPEDSPSDKSDTSESDVDMGDGYVMR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggttttgagccagaatgtctcagcggttggaccacttaatttgtatcccatggtatca
ctgtgtcatctgttccatagtttatcagtatttatgagttggtcacttctccccagacaa
gtgccatgcattggagagtatatgacagccttgttcccccacctactaaaaatgccccta
acccgccccccgactcgccaagtcgtggtgacatccaggaaacaaatgagaatccctact
tcccatcaccaagacctttcttcttccaccaaccctgtgcacatcagcctcgtgtttggt
atttcgtatgttttgcctgatttttcagatgaatcttgcactttaaagatgacattacga
aatttgcagtcaatcttatcatgggaattaaaaaaccattcaattgtaccaactcactat
acattatggtacaccatcatgagtaaacaagaagatatgaagatcgttggggactgtaca
aatatcacaagatcattctgtgacctaacagatgtgtgggtaaacatgacagagatgtac
atccccaaagtggttggattcagagggaacgcagcgctggtcagttgtgtgggctctttc
ttcctggcaatggacacactgcctttggacccaccagagtttgagattgttggttttaca
gaccacatcagtgtcaatgtgaaatttcagtctgtcgctcccaagatactaaatgaggaa
gaattacagttttacttagcattaattgaagaacagtcaggggggaccgttaagaagcat
aaaccccaaataaatggaaacgtcactgaaaatttcatttatgtcatcgacaagttaatt
ccaaaaacaaactactgtgtatctgtttattttgagcctaaacatccaagaaaaataaag
agatctcccttaaaatgtaccctctttcaacctggatgggaatcagagtcatcggaatct
gccacaataggaggaataattactctgtttctaatggctgctgtcgtcataagcactgta
atgatgctgaaacggatcggctacatatgcttaagaaataattcccccaaagttttgaat
ttttataaattgtcagtctgggtatttcccgagctgcctccgttggaaaaagtggctacc
gtggaggtcattcacatcaacagaaagaagaaagtgtggaattataattatgatgatgaa
agtgacagcgataatgaagcagccccccgaacaagcgcaggtggttacaccacgcacgga
ctaacgggcaggctgtggcccgcctctgtgtcctcggccaccttggaggactgcagtgac
ccggctgctgaggagcgtgacctgcccgatcccgaggctgatgctgagaccctgatggca
ccagggcccagcccctggcagtcggaatgcacaagtaggggctaccaggggagagggaac
ctgctgcaggaccccttttccgaggaggacagcagccccacggaggggtctggggacaga
attgtcttcaacgtggatttgaactctgtgtgcgtgagggcccttgaggacaacgacgac
tcagaagtcactccaatgttaccatctggtccagaagagacagtggtgctagaggacccc
gacgagacagaatcgaaccttcttctggtggccagtggagaagggacacagctgcccttc
cccggcccctctgcgcagtatccgtggcctgaagattctccttctgataaaagtgacact
tccgaatcggatgttgacatgggggacggttatgtaatgagatga

KEGG   Delphinapterus leucas (beluga whale): 111163875
Entry
111163875         CDS       T05885                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X1
  KO
K05135  interleukin 10 receptor beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163875 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163875 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111163875 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111163875 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111163875 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111163875 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163875 (IL10RB)
   04090 CD molecules [BR:dle04090]
    111163875 (IL10RB)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111163875 (IL10RB)
CD molecules [BR:dle04090]
 Proteins
  111163875 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac zf-MIZ Polysacc_synt_C
Other DBs
NCBI-GeneID: 111163875
NCBI-ProteinID: XP_022408682
UniProt: A0A2Y9LNP2
LinkDB
Position
Unknown
AA seq 361 aa
MAQSLRSWLGGCLLVSALGMVPPPENVRMNSVNFRNILQWESPAFPKGNLTFTAQYQSYR
KFQDICTSTVLTECDFSSLSKYGDHTLRVRAQFEDEHSDWINITFCPVDDTIIGPPRIQV
EALANSLHMRFLAPKIKNEPETWSMRNIYNSWTYHVQYWKNGSDEKFPVTGQYDFEVLRN
LESQTTYCVQVRGFLPDRNKTGEWSEPVCEQTAADEIAPSWIVAGVLGASVCTVLLTLTG
CFVLLRCVYKKAKHAIPPRNSLPQHLKEFLNHPHHSTLLLFSFPLSDENEVFDKLSVITE
ACESHKPNLGAGCSLRTLSEQGPSELASKEETHSAGHSDPLLLTPASEGDQSNRQTRAET
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcgcagagcctccggagctggctgggcggctgcctcctggtgtcagcattaggaatg
gtgccacctcctgaaaatgtcagaatgaattcagttaatttcaggaacattctacagtgg
gagtcgcctgcttttcccaaggggaatctgactttcacagctcagtaccaaagttatagg
aaattccaagatatatgcacaagtactgtcttgacggaatgtgatttctcaagtctttcc
aagtatggtgaccacaccttgagggtcagggctcaatttgaagacgagcattcagactgg
ataaacatcaccttctgtcctgtggatgacaccattatcggacctcccagaatccaagta
gaagcacttgctaattctttacatatgcgtttcttagccccgaaaattaagaatgaacct
gaaacatggagcatgaggaatatttataactcatggacttatcatgtgcaatattggaaa
aatggctcagacgaaaagtttccagttactggtcagtatgacttcgaggtcctccgaaat
cttgagtcacagacaacttactgtgttcaagttcgagggtttcttcctgatcggaacaaa
accggggagtggagtgagcctgtctgtgagcaaacagctgctgacgaaatcgccccctcc
tggatcgtggccggggtcctgggagcctcggtgtgcaccgtcctcctgacgctcactggc
tgctttgtcttgctgcggtgcgtttacaagaaggccaagcatgccatccccccgaggaat
tctcttccacagcacctgaaagagtttctgaaccaccctcatcacagcacacttctctta
ttctccttcccactgtctgatgagaatgaagtttttgacaaactgagcgtcatcacagaa
gcgtgtgaaagccacaagccgaaccttggggcgggctgcagccttaggaccttgtctgag
caggggccctctgagctggcctccaaggaagaaacacactcagccgggcacagcgacccc
ctccttctcacgcctgcctctgagggtgatcagagcaaccgacaaacaagggctgagacc
agctga

KEGG   Delphinapterus leucas (beluga whale): 111163885
Entry
111163885         CDS       T05885                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04066  HIF-1 signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163885 (IFNGR2)
   04066 HIF-1 signaling pathway
    111163885 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163885 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163885 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111163885 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    111163885 (IFNGR2)
   04659 Th17 cell differentiation
    111163885 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111163885 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163885 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111163885 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111163885 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111163885 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    111163885 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    111163885 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111163885 (IFNGR2)
   05140 Leishmaniasis
    111163885 (IFNGR2)
   05142 Chagas disease
    111163885 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163885 (IFNGR2)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IFN receptor family
   111163885 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 111163885
NCBI-ProteinID: XP_022408699
UniProt: A0A2Y9LGB1
LinkDB
Position
Unknown
AA seq 364 aa
MSQNEQRKNRIQGSRKGRLCGPQSLLLGRLNVAPSDTPFQLPAPRNLKVHLYNAQQALSW
EPVSLNNDTRLVVYQVQYKYSTSSTWYDVNRKDSRVDCTNLTGTECNFTANSLSEGFPRH
FNITLRLRAKLGDLVSAWVKAPWFEHYRNATIGPPEDIWVTPEEGSLIISFSSPFDVPAS
VAFFWYYVYYWEKGGSKQVTHRFRSNFITLNDLKPLRVYCFQLKAELFLAKENISRPGHL
SNISCSETTVDASTKLQQVILISMGTFLLLSVLVGACLFLVLKYRGLVKYWFHSAPSIPS
QIEEYLKDPAQPILDALDKDSSPKDDAWDSVSIVSFPENKQEDILQNTLNQSTDPSHQPV
EGGP
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtctcaaaatgaacaaaggaaaaaccgaatccagggctcgaggaaaggccgcctctgc
gggccacagagtcttctcctgggccgcctgaacgtagccccgtctgacacccccttccag
ctgcctgctcctcgaaacctgaaggttcacctgtacaacgcccagcaggctctgagctgg
gagcccgtgtccctgaacaatgacacaaggctggtggtctaccaggtgcagtataaatac
agcactagtagtacctggtatgacgtcaacagaaaagacagcagggtggattgtacgaac
ctcaccgggacagagtgcaactttaccgcaaacagcctctcagagggcttcccacggcat
ttcaacatcactttacgcctccgagctaagctgggggacctcgtctctgcctgggtaaag
gcgccttggttcgaacactatcggaatgccaccatcgggcctccagaagacatctgggtg
accccagaagagggttcccttatcatcagcttttcttctccctttgatgtccctgcctcg
gtggcctttttttggtattatgtctactactgggaaaagggaggaagcaaacaggtgaca
caccgtttcaggagcaacttcatcacgttgaatgatttaaaacccttaagagtatactgt
ttccaactcaaggcagaactgtttttggcaaaagaaaacatctctagacctgggcattta
agcaacatatcttgctccgaaacaacagtggatgcctctaccaagcttcaacaagtcatc
ctgatctctatgggaacctttctgttgctgtcagtgctggtgggggcctgtctcttcctg
gtgctgaaatacagaggcctggttaaatattggtttcactctgcaccaagcatcccatca
caaatagaagagtatttaaaggatccagctcagcccatcttagacgccttggacaaggac
agctcgccaaaggatgatgcctgggactctgtgtccatcgtgtcgtttccagagaataag
caagaagacattctccaaaacactttgaaccaaagcacagatccaagccaccagcccgtg
gaaggaggaccctga

KEGG   Delphinapterus leucas (beluga whale): 111165769
Entry
111165769         CDS       T05885                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111165769 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111165769 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111165769 (IL13RA2)
   04090 CD molecules [BR:dle04090]
    111165769 (IL13RA2)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111165769 (IL13RA2)
CD molecules [BR:dle04090]
 Proteins
  111165769 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind CBM_14
Other DBs
NCBI-GeneID: 111165769
NCBI-ProteinID: XP_022412435
UniProt: A0A2Y9LSW6
LinkDB
Position
Unknown
AA seq 387 aa
MAFIHLDIRCLYTLLLCTAFGSTLSSNAEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
NFKECTVEYELKYRNIGSASWKTIITKNLHYKDGFDLNKGVEAKIHTLLLGQCTNGSEVQ
SSWSEATYWISPQGNLETKIQDMDCVYYNWQHLLCSWKPGMCVHSDTNYNLFYWYEGLDH
VLQCADYIKANGKNIGCMFPYLESSDCKDFYICVNGSSESQVIRPSYFIFQLQNIVKPLP
PDYLSLTVKNSEEINLKWSIPKGPIPAKCFIYEIEFTEDDTAWVTTTVENEIYITRTSNE
SHELCFLVRSKVNIYCSDDGIWSEWSDEQCWKGDTWKETLIFFMIPLAFVSLLVLLITCL
ILYKQKNLLKTIFHTKKEASSNQVIQC
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggctttcattcatttggatatcagatgcctgtatacccttcttctttgcacagcattc
ggctctactttgtcttcaaatgctgagataaaagttaatcctcctcaggattttgaaata
gtggatcctggatatttaggctatctctatttgcagtggcaacctccactgtctctggat
aactttaaggaatgcacagtagaatatgaattaaagtatcgaaacattggtagtgcaagc
tggaagaccatcattactaagaatctacattacaaagatgggtttgatcttaacaaaggt
gttgaagcaaagatacacacacttctgctagggcaatgcacaaatggatcagaagttcaa
agttcatggtcagaagctacttattggatatcaccacaaggaaatctggaaactaaaatt
caggatatggattgtgtatattacaactggcaacatttactttgctcttggaaacctggc
atgtgtgtccattctgataccaattacaacttgttttattggtatgagggcttggaccac
gtgttacagtgtgctgattacatcaaggctaacggaaaaaatattggatgcatgtttccc
tacttggagtcatcagactgtaaagatttctacatctgtgttaatggatcatcagaatcc
caagttatcagacccagctatttcatttttcagcttcaaaatatagttaaacctttgcca
ccagactaccttagtcttactgtgaagaattcagaggaaattaacctgaagtggagcatt
cccaaaggacctattccagcaaagtgtttcatttatgaaattgaattcacagaagatgat
actgcctgggtgactaccacagttgaaaatgaaatatacatcacaagaacatcaaatgaa
agccacgaattatgctttttagtaaggagcaaagtaaatatttattgctcagatgatgga
atatggagtgagtggagtgatgaacaatgctggaaaggtgacacatggaaggaaacctta
atatttttcatgataccattggcttttgtctcattacttgttttgttaataacttgcctg
attttgtataagcaaaaaaatttgctgaaaacgatttttcataccaaaaaagaagcttct
tctaatcaggtgatacagtgctga

KEGG   Delphinapterus leucas (beluga whale): 111165942
Entry
111165942         CDS       T05885                                 

Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111165942
   04151 PI3K-Akt signaling pathway
    111165942
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111165942
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111165942
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165942
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111165942
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111165942
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 111165942
NCBI-ProteinID: XP_022412769
UniProt: A0A2Y9LSV2
LinkDB
Position
Unknown
AA seq 509 aa
MYHLGAPLWPGVGFLCLLLAGATWAPPPNPPDPKFERKAALLTAREPEEFLCFTERLEDL
VCFWEEAASAGVGPDNYSFSYQLEGEPWKPCRLHQAPTTRGLVRFWCSLPTADTSSFVPL
ELRVTAASSGSSRYRRIIHINEVVLLDPPAGLLARRADEGGHVVLRWLPPPGAPMASLIR
YEMNISAENAAGGAQRVEILDGRTECVLSNLRGGTRYTFKVRARMAEPSFGGFWSAWSEP
VSLLTASDLDPLILTLSLVLVLILLLLAVLTLLSHRRTLKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQTDGCLWWSPCTPFTEDPPAPLEVLSEHCWGVTQAVEPGVDDEGPLLEPV
GSEHAQDSYLVLDKCLLPRSPPSEDLPQPGGDLDIAAMDEASEAFSCSPALALKPVPEGA
LAASFEYTILDPSSQLLRPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQEAQRG
SSDGPYSNPYENSLIPAPEPSPPSYVACS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtatcatctcggggcacccctctggcctggagttggcttcctctgtctcctactcgct
ggggcaacctgggctcccccacccaacccaccggatcccaagtttgaaaggaaagcggcc
ctgctgacagcccgtgagcctgaagagtttctgtgcttcaccgagaggttggaggatttg
gtgtgtttctgggaggaagcggcaagtgccggggtcggcccggacaactacagcttctcc
taccagctcgagggtgagccgtggaagccgtgccgcctgcatcaggcgcccaccacccgc
ggcttggtgcgtttctggtgctcgctgcctacagccgacacgtcgagcttcgtgccccta
gagctgcgcgtcactgcggcctcctcgggctcttcacgctaccgccgtatcatccacatc
aacgaagtggtgctcctagaccctcccgctgggctgctggcgcggcgggcagacgagggc
ggccatgtggtactgcgctggctcccaccgcctggggcacccatggcaagcctcattcgc
tatgagatgaacatctcggcagagaacgccgctggtggcgcgcagagggtggagatcctc
gacggccgcactgagtgcgtgctgagcaacctgcgaggcggaacgcgctacaccttcaag
gtacgcgcgcgtatggccgagccgagcttcggtggcttctggagcgcctggtccgagcct
gtgtcgctgctgacggctagtgacttggaccccctcatcctgacgctctccctcgtcctc
gtgctcattctgctgctgctggccgtgctaaccctgctctcccaccgccggactctgaag
cagaagatatggcctggcatcccaagccccgagagcgagtttgagggcctcttcaccacc
cacaagggtaacttccagctgtggctgtaccaaactgatggctgtctgtggtggagcccc
tgcacccccttcacagaggacccacctgcccccctggaggtcctctctgagcactgctgg
ggggtgacacaggcagtggagccaggggtagatgatgaggggcccctgttggagccggtg
ggcagcgagcatgcccaagacagctacctggtgctggacaagtgcttgctgccccggagc
ccacccagcgaggacctcccacagcctggtggcgatttggacatagcagccatggatgaa
gcttcagaagcattctcctgctcacccgctttggccctgaagcctgtgccagagggggcc
ttggctgccagctttgagtacaccatcctggatcccagctcccagctcttgcgcccgagg
gcacttccccctgagttgccccctaccccaccccacctaaagtacctgtacctcgtggtg
tctgactctggcatctcaactgactacagctctgggggttcccaggaagcccagaggggc
tcatccgatggcccctactccaacccttatgagaacagcctcatcccagcccccgagcct
tcacccccgagctacgtggcctgctcctag

KEGG   Delphinapterus leucas (beluga whale): 111166139
Entry
111166139         CDS       T05885                                 

Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166139
   04151 PI3K-Akt signaling pathway
    111166139
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166139
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111166139
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166139
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111166139
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111166139
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 111166139
NCBI-ProteinID: XP_022413190
UniProt: A0A2Y9LSV2
LinkDB
Position
Unknown
AA seq 509 aa
MYHLGAPLWPGVGFLCLLLAGATWAPPPNPPDPKFERKAALLTAREPEEFLCFTERLEDL
VCFWEEAASAGVGPDNYSFSYQLEGEPWKPCRLHQAPTTRGLVRFWCSLPTADTSSFVPL
ELRVTAASSGSSRYRRIIHINEVVLLDPPAGLLARRADEGGHVVLRWLPPPGAPMASLIR
YEMNISAENAAGGAQRVEILDGRTECVLSNLRGGTRYTFKVRARMAEPSFGGFWSAWSEP
VSLLTASDLDPLILTLSLVLVLILLLLAVLTLLSHRRTLKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQTDGCLWWSPCTPFTEDPPAPLEVLSEHCWGVTQAVEPGVDDEGPLLEPV
GSEHAQDSYLVLDKCLLPRSPPSEDLPQPGGDLDIAAMDEASEAFSCSPALALKPVPEGA
LAASFEYTILDPSSQLLRPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQEAQRG
SSDGPYSNPYENSLIPAPEPSPPSYVACS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtatcatctcggggcacccctctggcctggagttggcttcctctgtctcctactcgct
ggggcaacctgggctcccccacccaacccaccggatcccaagtttgaaaggaaagcggcc
ctgctgacagcccgtgagcctgaagagtttctgtgcttcaccgagaggttggaggatttg
gtgtgtttctgggaggaagcggcaagtgccggggtcggcccggacaactacagcttctcc
taccagctcgagggtgagccgtggaagccgtgccgcctgcatcaggcgcccaccacccgc
ggcttggtgcgtttctggtgctcgctgcctacagccgacacgtcgagcttcgtgccccta
gagctgcgcgtcactgcggcctcctcgggctcttcacgctaccgccgtatcatccacatc
aacgaagtggtgctcctagaccctcccgctgggctgctggcgcggcgggcagacgagggc
ggccatgtggtactgcgctggctcccaccgcctggggcacccatggcaagcctcattcgc
tatgagatgaacatctcggcagagaacgccgctggtggcgcgcagagggtggagatcctc
gacggccgcactgagtgcgtgctgagcaacctgcgaggcggaacgcgctacaccttcaag
gtacgcgcgcgtatggccgagccgagcttcggtggcttctggagcgcctggtccgagcct
gtgtcgctgctgacggctagtgacttggaccccctcatcctgacgctctccctcgtcctc
gtgctcattctgctgctgctggccgtgctaaccctgctctcccaccgccggactctgaag
cagaagatatggcctggcatcccaagccccgagagcgagtttgagggcctcttcaccacc
cacaagggtaacttccagctgtggctgtaccaaactgatggctgtctgtggtggagcccc
tgcacccccttcacagaggacccacctgcccccctggaggtcctctctgagcactgctgg
ggggtgacacaggcagtggagccaggggtagatgatgaggggcccctgttggagccggtg
ggcagcgagcatgcccaagacagctacctggtgctggacaagtgcttgctgccccggagc
ccacccagcgaggacctcccacagcctggtggcgatttggacatagcagccatggatgaa
gcttcagaagcattctcctgctcacccgctttggccctgaagcctgtgccagagggggcc
ttggctgccagctttgagtacaccatcctggatcccagctcccagctcttgcgcccgagg
gcacttccccctgagttgccccctaccccaccccacctaaagtacctgtacctcgtggtg
tctgactctggcatctcaactgactacagctctgggggttcccaggaagcccagaggggc
tcatccgatggcccctactccaacccttatgagaacagcctcatcccagcccccgagcct
tcacccccgagctacgtggcctgctcctag

KEGG   Delphinapterus leucas (beluga whale): 111166190
Entry
111166190         CDS       T05885                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha isoform X2
  KO
K05136  interleukin 20 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166190 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166190 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111166190 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111166190 (IL20RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111166190 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 111166190
NCBI-ProteinID: XP_022413310
UniProt: A0A2Y9LV80
LinkDB
Position
Unknown
AA seq 482 aa
MYNFTRYGQKKWLNKSECRNISRTYCDLSAETSDYERQYYAKAKAIWGTNCSKWAETGRF
YPFLETQIGPPEVALTTDEKSISIVLTAPKKWKKNPEESSISLEQIYSNLKYNVSIHNTK
SNRTWSQCVTNRTLVFGWLEPDTLYCVLVESFVPGPPRLVQPSEKKCVSTLKDQTSTLKV
KIIFCYVLPISVTVFLFSVMCYSMYRYTYVGKEKHPANLILICGNEFDKRVFVPAEKVVI
NFITLNILEDSKTSHKDISVMEKSNDASDLNEPSKDQEPHQEEVEVKHLGYASHVVDIVY
DPEKSTKGTSLSQQEPPSRTMPTDKTVIEYECDVRTSDISVGPGDQEFNLQEEVSLQGKL
SEQQATLADLGPQTLPYSYTPQLRDLDHLPQGHVDTEEGPEAEPSTTLVDWDPRTGRLCI
ASLSSCEHDSERCKHPESEGLEDEGLLSRLYQDQAPDKTLEEHEAYLMQFMEEWGLYVQM
ED
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgtacaattttaccagatatgggcaaaagaaatggctgaataaatccgaatgcagaaat
atcagtaggacctactgtgatctctctgctgaaacttctgactacgaacgtcaatattat
gccaaagctaaggccatttggggaacgaattgttctaaatgggcagaaactggacgattc
tatccttttttagaaacacaaattggcccaccagaggttgctttgactactgatgagaaa
tccatatctattgttctgacggctccaaagaagtggaagaaaaacccagaagaaagctct
atttccctggaacaaatatactctaatctgaagtataatgtgtccatacataatactaaa
tcaaatagaacgtggtcccagtgtgtgacaaaccgaacgctggtattcggctggctggag
ccggacactctgtactgcgtcctcgtggagtccttcgtcccaggccctcctcgccttgtt
cagccatctgagaagaaatgtgtcagtactttgaaagatcaaacatcaacactgaaggtt
aaaatcatcttctgctatgttttgcccatatctgttactgtgtttcttttttctgtgatg
tgctactccatgtacagatatacctacgtcggcaaagagaaacacccagcaaatctgatt
ttgatttgtggaaatgaatttgacaaaagagtctttgtacctgctgaaaaagttgtgatt
aactttatcaccctcaatattttggaggattctaaaacttctcataaggatataagtgta
atggaaaaaagcaatgatgcatcagacctgaatgagcccagcaaggaccaggagccccat
caggaggaagtggaggtgaaacacctgggatatgcttcacatgtggtggacattgtgtat
gaccctgagaaaagcaccaaagggacttccttaagccagcaagagccacccagcaggaca
atgcccacagacaaaacagtcatcgaatatgaatgtgatgtaagaactagtgacatttct
gtggggcctggagatcaggagttcaatttgcaggaggaagtgtccctacaaggaaagtta
tctgagcaacaggcaactttagcagacttgggtccacaaacactaccatattcatatacc
cctcagctcagagacttggaccacctgccgcaggggcatgtggacacagaggaggggcca
gaggcagaaccatcaaccacactggtcgattgggaccctcggactggcaggctgtgtata
gcttcattatccagctgtgaacatgactcagagaggtgtaagcaccctgagtctgaggga
ctcgaggacgagggcctcttatctagactctaccaggatcaggctccagacaagacactg
gaggaacatgaagcctatctcatgcagtttatggaggaatggggattatatgtacaaatg
gaagactaa

KEGG   Delphinapterus leucas (beluga whale): 111166198
Entry
111166198         CDS       T05885                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04066  HIF-1 signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166198 (IFNGR1)
   04066 HIF-1 signaling pathway
    111166198 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166198 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166198 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111166198 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    111166198 (IFNGR1)
   04659 Th17 cell differentiation
    111166198 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111166198 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166198 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111166198 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111166198 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111166198 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    111166198 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    111166198 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166198 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111166198 (IFNGR1)
   05140 Leishmaniasis
    111166198 (IFNGR1)
   05142 Chagas disease
    111166198 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111166198 (IFNGR1)
   04090 CD molecules [BR:dle04090]
    111166198 (IFNGR1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IFN receptor family
   111166198 (IFNGR1)
CD molecules [BR:dle04090]
 Proteins
  111166198 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Comm Shisa Renin_r
Other DBs
NCBI-GeneID: 111166198
NCBI-ProteinID: XP_022413334
UniProt: A0A2Y9LUF6
LinkDB
Position
Unknown
AA seq 469 aa
MALFLLLVLIVQAGSWAEMGAADQKLSSVPTPTNLTIEAYNLNTVLFWDYPIMPWSPVFT
VQVMTYRDGQWIDACNTSHHSCNIFSIIDDPSSPLWARVKARLGQEESVYAQSREFILCK
EGRIGPPKLVITKKEDQIIVDIFHPLITVNENEPEAIYDDENTCYTFTYNVFVRINGSET
TNKMYIKKEDDCNETQCFLSIPVSSLNSEYCVSAEGVSETWAVTTEKSEELCITVSDNNS
AENPVWIPIVAALLLFLVLALVVVCCLVKKMNPFKRENIMLPKSLLSVVKSASSETKSES
KHISPITYQPIAIENEQLSPGTISSVHTEDSPGKAEHGEDLSSGTQVVMTEENISDLAPG
SSLTPVKGENSIHASSNQSETCSITLNVYHARNGSDSGLVVSGNCSDSEFPPSNKTEIKT
EGRESITLRNTITSFGYDKPHVLVDLLVDEGGKESLIGYRPTADSREFS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggctctcttccttctcctcgtccttatcgtgcaggccggaagctgggctgagatgggc
gccgcggatcagaagctgtcctcagtgccaacaccaaccaatctcacaattgaggcctat
aacttgaatactgttctattttgggattacccaattatgccatggagccctgtgtttacc
gtacaggtgatgacctatagggacgggcaatggattgatgcctgcaatacctcccatcat
tcttgtaatatcttttccataattgatgatccatcaagtcctctctgggctagagttaaa
gctaggcttggacaagaggaatcagtctatgcacagtcaagagaatttattttatgcaaa
gaagggagaattggaccacctaaactggttatcacaaagaaggaagaccaaatcattgtt
gatatatttcaccctctaattactgtaaatgaaaacgaaccagaagccatatacgatgat
gaaaatacttgttatacattcacgtacaatgtgtttgtgagaataaatggaagtgaaacc
acaaataaaatgtacataaagaaagaagatgattgtaatgagactcagtgcttcttaagt
attcctgtgtcctcgctgaattctgagtactgcgtttcagcagaaggagtctcagaaacg
tgggctgttacaactgagaagtcggaagaactttgtattaccgtttctgataataacagc
gcagaaaatcctgtttggattccgattgttgctgctttactactctttctagtacttgcc
ctggtagttgtatgttgtctcgttaagaagatgaatccatttaagagagaaaacatcatg
ttacccaaatccttgctgtctgtggtaaaaagtgcctcttcagagacaaaatctgaatca
aaacatatatcgcccatcacctaccaaccaattgccatagaaaatgagcagctctctcca
gggacaatttcaagcgtgcatactgaggacagtccaggaaaagcagagcatggagaagac
ctttctagtggaacacaagtggtgatgactgaagaaaatatttctgacttggcccctggt
agctctttgaccccagtaaagggagaaaattctatccatgcaagcagtaaccagtctgaa
acctgcagcatcactttaaatgtgtatcacgccagaaatggttctgatagtggccttgtg
gtatcaggcaactgctctgactcagaatttcccccaagtaataaaactgaaataaagaca
gaaggacgagagtccataacgctgagaaacaccatcacctcctttggttatgacaaaccc
catgtgttagtggatctgcttgtagatgaaggtggtaaagagtccttgattggttataga
cctacagcagattccagagagttttcataa

KEGG   Delphinapterus leucas (beluga whale): 111166637
Entry
111166637         CDS       T05885                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha isoform X1
  KO
K19598  interleukin 27 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166637 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166637 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111166637 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111166637 (IL27RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111166637 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 111166637
NCBI-ProteinID: XP_022414226
UniProt: A0A2Y9LZI4
LinkDB
Position
Unknown
AA seq 656 aa
MRGTRAAPFPPRRRPKLVLLPLLMLLFCRTRPQGSPGPLQCYGFGPLGDLNCSWEPLGDL
GAPSTLYLQSQKYHSNKTWTVAVPTGQSWVTIPREQLTTSDELLVWVAKAGQPLWPPVFV
NLETRMKPDAPQLYPDVDFSEDDPLEATVQWAPPMWPPHKVLVCQFYYRRCQEMAWMLLE
PEVKSIPLTPVDIQDLELATGYEVSGRCQVEEEEDLWSEWSPILSFQTPPSAPKDVWISG
NICGAPGGQEPLLLWKASGHCVQVSYRVWFQIKDQEVIQEETSCCNISIPTQAEWAGVSA
INATSWEPPTNLSLACLGPGFAPRGVVVSIIPVSSDLLVTWQQGSGGLQEHVVDWARDGD
PLEDLNWVWLPPGNLSAVLPGDFEGGVPYQITVTAVSPWGLAPAPSVWKFREELVPLAGP
VLWRLQDSPPGTPAVAWGEVPRHQLRGHLTHYTLCAQSRTRPSVCMNVSGSTRTITLPDL
HWGTCELWVTASTIAGQGPPGPSLRFHLPDNTLKWKVLPVVLLVWGLLLTGCGVSLATSG
RCVHLRHKVLPHWVWEKVPDPANSNFSLPHMKEVPQAQPPGDLPILEVEEIEQVPIMEAP
QASAPLDSGYEKHFLPTPEELGFLGHTPGSRLWTEPTPGGERGAHLTDEDTEAQRS
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgcggggaacccgggccgctcccttcccgccgcggcggcggccgaagctggttttgctg
cctctgttgatgctgctattctgcaggactcggccccagggcagccctgggccattgcag
tgctatggatttggacccttgggcgacttgaactgctcatgggagcctcttggggacctg
ggagccccttccacgctgtacctccagagccagaagtaccattccaacaaaacctggact
gtggcagtgcccactgggcagagctgggtgaccattccacgggaacagctcaccacgtct
gacgaactccttgtctgggtggccaaggcaggacaacctctctggcccccagtcttcgtg
aacctcgaaacccgaatgaagccggatgccccccaactgtaccctgatgtggacttctca
gaggatgaccccctagaggccactgtccaatgggcccctcctatgtggccaccccataag
gtcttggtctgccagttctactaccgaagatgccaggagatggcctggatgctgctggaa
cctgaagtgaaatccatacccctgacccctgttgatatccaggacctggagctagccact
ggctatgaggtgtctggccgctgtcaagtggaggaagaagaggatctgtggagcgagtgg
agccccattctgtccttccagacaccaccctctgctccaaaagatgtgtggatatcaggg
aacatctgtggggcaccaggcggacaggaacccctgcttctgtggaaggcctcggggcac
tgcgtgcaggtgagctacagagtctggttccagattaaagatcaggaggtgatccaggag
gagacctcatgttgcaacatctccatccccactcaagcggagtgggctggggtgtccgcc
atcaacgccacaagctgggagcctcctaccaacctctctttggcctgcttgggtccaggc
tttgcccctcgtggtgtggtggtcagcatcatccctgtaagctcggacctgctggtgact
tggcaacaggggtccggggggctgcaggagcatgtggtggactgggctcgagatggtgac
cccctggaggatctcaactgggtctggcttcctcctggaaacctcagtgctgtgttgcca
ggggatttcgaaggaggggtgccctaccaaatcacggtgacagcagtctctccttggggc
ttggcccctgccccctcagtctggaagttcagagaggaactagtacccctggcagggcca
gtgctttggcgactccaggatagccccccagggacccctgctgtagcgtggggagaggtc
ccaaggcaccaacttcggggccatctcacccactacaccctgtgtgcacagagtaggacc
aggccttctgtctgcatgaatgtgagcggcagcacccggaccatcaccctgcccgacctt
cactggggtacctgtgagctgtgggtgaccgcgtccaccatcgcaggacagggcccaccg
ggtccaagcctccgctttcacctaccagataacaccctgaaatggaaagttctgccagtt
gtccttctcgtatggggtttgctcctgacgggctgtggcgtgagcctagctacctccgga
aggtgtgtccacctgcggcacaaggtactaccccactgggtctgggagaaggttcctgat
cctgccaacagtaatttcagcctgccccacatgaaggaggtgccccaggcccagccccct
ggggacttgcccatcctggaagtggaggagatagagcaggtaccgattatggaggccccc
caggcctcagccccactggactctggatatgagaaacacttcctgcccacacccgaggag
ctgggctttctgggccacaccccaggttccaggttatggactgaaccaaccccaggaggg
gagaggggtgctcatttgacagatgaagacactgaggctcaaagaagctga

KEGG   Delphinapterus leucas (beluga whale): 111166653
Entry
111166653         CDS       T05885                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166653 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166653 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111166653 (IL12RB1)
   04659 Th17 cell differentiation
    111166653 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166653 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111166653 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111166653 (IL12RB1)
   04090 CD molecules [BR:dle04090]
    111166653 (IL12RB1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111166653 (IL12RB1)
CD molecules [BR:dle04090]
 Proteins
  111166653 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 111166653
NCBI-ProteinID: XP_022414266
UniProt: A0A2Y9LZM2
LinkDB
Position
Unknown
AA seq 726 aa
MGQRVTRLVSLFLLLLPRQGAEACGTMGCCFQDPPYPDADSGLASGPRDLNCYRILSNAG
YECSWEYEGPAAGVSHFLRCCLKPGRCCYFAAGSATKLQFSDQDGISVLHAVTLWVESRA
ANWTEKSPNITLNLYSSVKYDPPPGNIKVSRSAGQLLMEWETPAHQDGAEVQFRHRTPGS
PWKWGDCGHQDDAGFESCLCPLEMDTAQEFQLRRRLRPGVSGGPWSSWSSPVCIPPETPP
QAKVRFSVEQLRPNGRRKVTLHEQLPQLELPEGCLGPDSGMEVTYHVHLHMLSCPCKAKA
TRTLRLRKKLSLSGAAYDLVVVSRNRFGLGPNQTWHIPAYTHSEPGVLNISTRANRTTMH
WPARAQGMTYCIEWQPQGQDESLATCTLTAPQDRDPDGMATHSLSQASGAMWQKECYRIT
IFASVHPEKPTSWSTVLSTFHFGGNASEAGSPQHVSVKKLSRDSVSVDWTPSLLSTCPGI
LKEYVVRCQDEASNQVSELSVNATETQITLQGLRAATAYKVQVRADTAKWRGAWSQPLRF
TVEVQVSELSDLSVFLASFGSFVSILLLGIFGYLGLNRAVRHLCPPLPTPCASTAVEFSG
SQGKQVWQWNSPADFPEEVSQQEALVVNISWDKGERTDVDTAGLLKEKMELPLGAPEPAL
DTELPLKDRKWVQGCPEAGTLGPGWKDSLEDNPAQAAGLPLLLGDLRQTPKFRSQGETET
SASPYR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggggcagcgggtgaccaggctggtctccctctttctcctcctgctaccccggcagggc
gctgaagcctgtggcaccatggggtgctgttttcaggatccaccgtatccggatgcagac
tcaggcttagcttcgggcccccgggacctaaactgctaccggatactcagcaacgctggt
tatgaatgttcctgggaatatgagggccccgcagctggggtcagccacttcctgagatgc
tgcctcaagcctgggcgctgttgctactttgccgcaggctcagccaccaagctgcagttc
tctgaccaggatggcatatccgtgctccacgctgtcactctctgggtggaatcccgggct
gccaactggacagagaagtcccccaacattaccctgaacctctacagctcagttaaatac
gaccctccaccaggaaacatcaaggtgtccaggtcagcagggcagctgctcatggagtgg
gagaccccagcccaccaggatggtgctgaggtacagttccggcaccggacacctggcagc
ccgtggaagtggggcgactgtggacatcaggatgatgctggcttcgagtcatgcctctgc
cccttggagatggacacggcccaggaattccagctgcggcgacggctgaggccaggggtc
tccggaggtccctggagcagctggagcagccctgtgtgcatcccccctgaaaccccccca
caggccaaggtgaggttctcggtggagcagctccgcccgaatgggaggaggaaggtgacc
ttgcatgagcagctgccccagctggagcttccagaaggctgcctcgggcccgactcaggc
atggaggtgacctaccatgtccacctgcatatgctgtcctgcccatgtaaggccaaggcc
acgaggactctgcgcctgcggaaaaagctcagcctctcgggtgccgcctatgacctggtt
gtcgtttcccggaatcgctttggcctcggtcccaaccagacatggcacattcctgcctat
acccactcagaaccaggggtcctgaatatcagtaccagagccaacaggaccaccatgcat
tggccagcccgggcccagggcatgacatactgcattgagtggcagccccagggccaggac
gagagccttgccacctgcaccctgacggcaccccaggaccgggaccctgatggaatggca
acgcacagcttgagccaagcatctggggcaatgtggcagaaggagtgttaccgcatcact
atctttgcctctgtacacccggagaagcccacctcgtggtccaccgtcttgtccaccttc
cactttggaggcaatgcctcggaggccgggagcccacaacatgtgtctgtaaagaaactc
agccgggattcagtgtctgtggactggacaccatctctgctgagcacctgccccggcatc
ctgaaggagtacgttgtgcgctgccaggatgaggccagcaaccaagtatccgagctgtca
gtgaatgccacagagacccagatcaccctccagggcctgcgggctgccacagcctacaag
gtgcaggttcgagcagacacagccaagtggcggggtgcctggagccagcccctgcgcttc
accgtcgaagtccaggtttctgagttgtccgatttgtccgtcttcctcgcatcttttggg
agcttcgtgagcatccttctcctgggaatctttgggtacctcggcttgaacagggctgta
aggcacctgtgcccacccctgcccacaccttgtgccagcactgccgtcgagttctctggc
agccaggggaagcaggtttggcagtggaacagcccggcagacttcccggaggaggtgtcc
cagcaagaggccctggtggtgaacatatcctgggacaaaggagagcgaactgacgtggac
acagctgggcttctcaaggagaagatggagctgcctctgggtgcccctgagccagccctg
gacacggagctgcccttgaaagacaggaaatgggtgcagggatgccctgaggctgggacc
ctggggcctggctggaaggacagtctggaggataaccctgcccaggcagctggactcccg
ctcctcctgggagacctaaggcagacccccaaattccgttcccagggagaaacagaaaca
tctgcctccccttacagatag

KEGG   Delphinapterus leucas (beluga whale): 111166949
Entry
111166949         CDS       T05885                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166949 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166949 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111166949 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111166949 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111166949 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111166949 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111166949 (IL10RA)
   04090 CD molecules [BR:dle04090]
    111166949 (IL10RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111166949 (IL10RA)
CD molecules [BR:dle04090]
 Proteins
  111166949 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 111166949
NCBI-ProteinID: XP_022414933
UniProt: A0A2Y9MBZ2
LinkDB
Position
Unknown
AA seq 579 aa
MLPRLIVQLAALLSLLLGFRTHELPRPSSAWFEAEFFYHVLHWTPIPNQSESTYYEVELL
RYGVEPIYWNPIRSCSQTLVLSCDLTMQTLDLYHSNGYRARVRAVDGGQHSNWTYPNTRF
SVDEVTLTVAGVKLEMHDGIIFGVIQLPRPKMAPAGDTYESIFHNFREYEIEVRKVPGQY
KSHDKIKHENFNLPVPRGVGEFCVRVKPSVSSRVNKEVWSKEECIVLTPQYFTVTNLSIF
FTFVLLLCGALAFFLALQLYVQRRGKLPTVLVFKKPSPFSLISQLSCPETQDTIHPLDEQ
AFPKVSPELRNSELHGSTDSGFSSAKPSLQTDEPQFHLPAPHPQAGGTLGKGAPRLPEDS
CSSGGSKSTDSGICLQEPSLSPGTEPSWAPQAGSDSQDQLDSGIGLVQNPEGQPEDVQGG
SALGHVSPLGPEVAAGEDPAAGAFQGYLKQTRCPEERAAEAGGLEEESSSTDGLGPKFRT
CVDAEVDWPLPALAKGYLKQDPPEMTLTPSGAPAGQWNPPTEDWSLLGLTRCGDLGASDW
SFAHDLAPLDCVAAPGGLLGSFDSDLVALPLISSLHSSE
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgctgccgcgcctgatagtgcagcttgcggccctcctcagcctgctcctcggctttcgc
acgcacgaactgcccagaccttcatctgcatggtttgaagcagaatttttctaccacgtc
ctccactggactcccatcccgaatcagtctgaaagtacctactatgaagtggagctcctg
cggtatggagtagagcccatctactggaaccccatccgcagctgtagccagaccttggtg
ctgtcctgtgatctcaccatgcagaccctggacctgtatcatagcaatggttaccgagcc
agagtccgggcagtggacggaggccagcactcaaactggacctatcccaacacccgcttc
tctgtggatgaagtgactctgacagttgccggcgtgaagctagagatgcacgatggcatc
atctttggggtgatccagctccccaggcccaagatggcccctgcaggcgacacatatgaa
agcatcttccacaacttccgggagtatgagattgaggttcgcaaggtaccaggacaatat
aagtcccatgacaagataaaacatgaaaactttaacctcccagtcccgagaggggtggga
gagttctgtgtcagggtgaaaccatctgtcagctcccgagtgaacaaggaggtctggtcc
aaggaggagtgcatcgtgctcaccccgcagtatttcaccgtgaccaacctcagcatcttc
ttcacctttgtcctgctgctctgtggagccctggccttcttcctggccctccagctgtat
gtgcagcgccgggggaagctgcccaccgtcctggtcttcaagaagcccagtcccttcagc
ctcatcagccagctttcctgcccagagacccaagacaccattcatcccctcgatgagcag
gccttccccaaggtgtccccagagctgaggaactcggagctgcacggcagcacggacagt
ggcttcagcagtgccaagccatccctgcagactgacgagccccagttccacctccctgcc
ccccacccccaggctgggggtactttgggaaagggggcgccccggttgccggaggacagc
tgcagtagcggcggcagcaaaagtacagacagcgggatctgcttgcaggagcccagcctg
agtcctggcacggagcccagctgggcgccgcaggcggggagcgacagccaggaccagctt
gacagtggcattggcctggtccagaaccctgaggggcagcctgaggatgttcagggtggc
tcagctttgggccatgtgagtcccctgggaccggaggtggctgcgggagaagacccagct
gcaggggccttccagggctacctgaagcagacccggtgcccggaggagagggcagccgag
gcaggcggcctggaagaagagtcctcctcaacagatggccttggccccaaattcaggaca
tgcgtggatgctgaggtggactggcctctaccagccctggccaagggctatttgaaacag
gaccccccagaaatgactctcactccctcaggggccccagctggacagtggaacccacca
actgaggattggtcactcctgggcttgacccgctgtggtgaccttggagcatccgactgg
agctttgcccacgaccttgcccctctggactgtgtggcagccccaggcggtctcctgggc
agcttcgactcagacctggtcgccctgccactgatctccagcctgcactcaagtgagtga

KEGG   Delphinapterus leucas (beluga whale): 111167075
Entry
111167075         CDS       T05885                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04066  HIF-1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04659  Th17 cell differentiation
dle04932  Non-alcoholic fatty liver disease
dle05163  Human cytomegalovirus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111167075 (IL6R)
   04066 HIF-1 signaling pathway
    111167075 (IL6R)
   04151 PI3K-Akt signaling pathway
    111167075 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111167075 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111167075 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111167075 (IL6R)
   04659 Th17 cell differentiation
    111167075 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111167075 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111167075 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111167075 (IL6R)
   05163 Human cytomegalovirus infection
    111167075 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111167075 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111167075 (IL6R)
   04090 CD molecules [BR:dle04090]
    111167075 (IL6R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111167075 (IL6R)
CD molecules [BR:dle04090]
 Proteins
  111167075 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 Ig_5 I-set
Other DBs
NCBI-GeneID: 111167075
NCBI-ProteinID: XP_022415183
UniProt: A0A2Y9MCS4
LinkDB
Position
Unknown
AA seq 465 aa
MLAVRCALLTALLATPGTALAPGGCPALEVANDVLTSLPGASVTLTCPGGEAGDNATVHW
VLRNQVTGSRQGRWAGVGRRLLLRSVLLSDSGNYSCYEDGRPAGSVRLLVDVPPEEPQLS
CFRRSPLSNVGCEWSPRSPPSPTTKAVLLVRKFPVKDFQEPCQYSPESQQFSCQLAVPEG
DNSLYVVSLCVSNSAGSQSSRPQTFEGYGILQPDPPVNVTVTAVDRNPRWLSVTWQDPPS
WNSYFYRLQFELRYRAERSKTFTMWMVKELQYHCIIHDAWSGMKHVVQLRAQEEFGHGLW
SEWSQEVTGVPWTESKSSPAETELPPCTQAPTTNEDNENIFSKDSANATSLPVQDSTSVP
LPTFLVAGGSLAFGTLLCIGIVLRFKKTGKLQALKEGKTSVHPPYSLGQLVPERPKPTPV
LVPLISPPVSPSSLGSDNTSRTSRPDASGPQRPYDVSNRDYFFPR
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctggccgtccgctgcgcgctgctgaccgccctgcttgcgacgcccgggacggcgctg
gccccggggggctgccccgcgctggaggtggcaaacgatgtgctgaccagcctgccaggg
gccagtgttaccctgacctgcccaggtggggaagcgggggacaatgccaccgttcactgg
gtgctcaggaatcaggtcacaggttcacgccaaggcagatgggctggtgtgggaaggagg
ctgcttctgaggtctgtgctgctcagcgactctggaaactattcgtgctacgaggatggc
cgcccggctggaagtgtgcgtttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaggagccccctcagcaacgtgggttgtgagtggagtcctcggagtcccccg
tccccgaccaccaaggccgtgttattggtgaggaagtttccggtgaaagacttccaggag
ccgtgccagtactccccggagtcgcagcagttctcctgccagttggcagtcccagaggga
gacaactctttgtacgtcgtgtccctgtgtgtctccaacagtgctgggagccagtccagc
agaccccaaacatttgagggttatggaatcctgcagcctgacccacccgtcaatgtcacg
gtcaccgccgtggacagaaacccccgctggctcagcgtcacctggcaagaccccccttcc
tggaactcatatttctacaggttacagtttgagctccgataccgggctgaacgatcaaag
acattcacaatgtggatggtcaaggagctccagtatcactgcatcatccacgatgcctgg
agtggcatgaagcatgtggtgcagcttcgggcccaggaggagtttgggcatggcttatgg
agtgagtggagccaggaggtcacgggcgtcccttggacagaatccaagagttctccagct
gagactgagctgcccccctgcacacaggcacctactactaatgaagataatgaaaatatt
ttctccaaagattctgcaaatgcaacaagcctcccagttcaagattctacttcggtacca
ctgcccaccttcctggtggctggaggaagcctggccttcgggacgctcctctgtattggc
attgtcctgaggttcaagaagacggggaagctgcaggctctgaaagaaggcaagacgagc
gtgcacccaccgtattctttgggacagctggtccctgagaggcccaagcccaccccagtg
cttgtgcccctcatctccccgccggtgtcccccagcagccttgggtctgacaacacctcg
aggactagccgaccagatgccagtggccctcagagaccttatgacgtcagcaacagagac
tacttcttccccagatag

KEGG   Delphinapterus leucas (beluga whale): 111167807
Entry
111167807         CDS       T05885                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
dle05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111167807 (IL2RG)
   04151 PI3K-Akt signaling pathway
    111167807 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111167807 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111167807 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111167807 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111167807 (IL2RG)
   04659 Th17 cell differentiation
    111167807 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111167807 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111167807 (IL2RG)
   05340 Primary immunodeficiency
    111167807 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111167807 (IL2RG)
   05162 Measles
    111167807 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111167807 (IL2RG)
   04090 CD molecules [BR:dle04090]
    111167807 (IL2RG)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111167807 (IL2RG)
CD molecules [BR:dle04090]
 Proteins
  111167807 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 111167807
NCBI-ProteinID: XP_022416783
UniProt: A0A2Y9MHV1
LinkDB
Position
Unknown
AA seq 381 aa
MLKPRLPLRSLLFLQLPLLGVGLNPKVLTPNGNEDITAGGKPGTGGDFFLTSTPAGTLNV
STLPLPKVQCFVFNVEYMNCTWNSSSEPQRTNLTLHYGYKNFNDDDKLQECGHYLFSEGI
TSGCWFGKKEIHLYQTFVVQLQDPWEHRRQPEQLLKLQDLVIPWAPENLTLRNLSEFQLE
LSWSNRHLDHCLEHLVQYRSDRDHSWTEQAVDHRHSFSLPSVDAQKFYTFRVRSRYNPLC
GSAQQWSDWSCPVHWGSNTSKENPENPETLSLSAWKTVLIPVVPMAFIVSLICLYCWLER
TMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPKGGEGPGG
SPCSQHSPYWAPPCYTLKPEP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgttgaagccacgattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaacccaaaggtcctcacgcccaatgggaatgaagacatcacagctggtggg
aaacctgggactggaggagacttcttcctgacctctacacccgctgggaccctcaatgtt
tccactctgcccctcccaaaggttcagtgttttgtgttcaatgtcgagtacatgaattgc
acctggaacagcagctctgagccccagcgcaccaacctgactctgcattatgggtacaag
aactttaatgatgatgataaactccaagagtgtggccactatctattctctgaagggatc
acttctggctgttggtttggaaaaaaggagatccatctctaccaaacatttgttgtccag
ctccaggacccatgggaacacaggaggcagcccgaacagttgctaaaactgcaggatctg
gtgatcccctgggctccagagaatctgacacttcgcaacctgagtgaattccagctagaa
ctgagctggagcaacagacacttggaccattgtttggagcacctggtgcagtaccggagt
gaccgggaccacagctggactgaacaagccgtggatcacagacatagcttctctctgcct
agcgtggacgcacagaaattctacacgttccgtgttcgaagccgctataacccactctgt
ggaagcgctcagcaatggagtgactggagctgccccgttcactggggcagcaatacttca
aaggagaatcctgagaatcctgagactctttcgttgtctgcatggaaaactgtgctgatc
cccgttgtccccatggcatttatcgtgagcctcatctgtttgtactgctggctggaacgg
acgatgccccgaattcctaccctcaagaacctagaggatctggttactgaataccacggg
aacttttcggcctggagtggtgtgtctaagggactggcagaaagtctgcagccagactac
agtgaacggctttgccacgtcagtgagatccccccaaaaggaggggaagggcctgggggc
tccccctgcagccagcatagcccctactgggctcctccatgttacaccctgaaacctgag
ccctga

KEGG   Delphinapterus leucas (beluga whale): 111168262
Entry
111168262         CDS       T05885                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111168262 (IL3RA)
   04151 PI3K-Akt signaling pathway
    111168262 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111168262 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111168262 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111168262 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168262 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111168262 (IL3RA)
   04090 CD molecules [BR:dle04090]
    111168262 (IL3RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111168262 (IL3RA)
CD molecules [BR:dle04090]
 Proteins
  111168262 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind Y_Y_Y InlK_D3 IL12p40_C
Other DBs
NCBI-GeneID: 111168262
NCBI-ProteinID: XP_022417593
UniProt: A0A2Y9MKA6
LinkDB
Position
Unknown
AA seq 473 aa
MDGLASVPGRLPVTGSSGSDPLPCPGKGSLGLPSTQFGKKDPGCRLLVSNLCESWHFWGT
RSVLGNLVGAPDLDGGAAGARPPVGAALAMAFVWLAVFLVPVSGLLPPDHDPYPIDISDP
DPPIKNLRMEPERKRLTWDLHGNVSEIMCFINSKAFTKARKRTYCSFLDLSCQATNYSIK
VTKGQPFSTWIQYPSQEGNPRAAAENLTCWVHDVDFLTCSWAVGREAPRDVQYNLYLENL
DSYEKWPCSQYRADEQGTNVQCRFHNISLLSKDQTRFLVNGTSSGSKIPCSETSDRLAKI
EVLAAPNITSRWCNQSYSFMQWQVRSHLNDDFKYELQIQKGTELPYKQEIYKAFLELNNP
GTYTVQVRARDATFSHYKPWGPWSVPQHFVCEEGARLPVWLTSLLIALGTLLAMGLVLRF
CRFSVMQKLFPPIPHMKDHINGKLQNGRTMTWDPDQDSQEECPVAEVQVLGET
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggatggtttggcatctgtcccgggacgcctccctgtgacgggcagttccggatctgac
ccgttgccttgtcctggaaaggggtctctcgggcttccctccacccagtttggcaagaag
gaccctgggtgtcggcttctggtgtcaaatctgtgtgaaagttggcacttttgggggacc
aggtcagtcctggggaatcttgtgggagccccagacctggatgggggagcagctggcgcc
cgccctcctgtgggagctgccttggccatggctttcgtctggctggcggtcttcctggtg
cccgtctccggcctgctgccaccggaccacgacccttaccctatagacatttccgatcca
gacccaccaattaagaacctaaggatggagccagaaagaaaaagattgacctgggacctc
catggaaacgtttccgaaattatgtgtttcatcaattcaaaagctttcactaaggcacgg
aaaaggacgtattgcagttttcttgacttgtcatgccaagctacaaactacagcatcaag
gtgaccaaaggtcagccattctccacgtggattcagtatcctagtcaagaagggaatccc
agggcggctgcagaaaacctgacctgctgggttcacgacgtggatttcctgacgtgcagc
tgggcggtgggccgggaggccccgagggacgtgcagtacaatctctacctggagaacctg
gactcctatgagaagtggccgtgctcccagtacagagcagatgagcaagggacaaacgtc
cagtgccgttttcacaacatctctctgttatccaaggatcagacgcgtttcctggtgaat
ggcaccagcagtggttccaaaatcccctgctctgaaacgagtgatagactagccaaaatc
gaggtattagctgctcccaacatcactagcaggtggtgtaaccaaagctactcgttcatg
cagtggcaagtgaggagtcaccttaatgatgacttcaagtatgaactgcagatacagaag
ggtacggagctcccctacaaacaggagatctataaagccttcttggagctgaacaatcct
gggacctacacggtgcaagtaagggccagggatgccaccttctcccattacaaaccttgg
ggcccgtggagtgtcccccaacacttcgtgtgtgaggagggcgcgcgcctccccgtctgg
ctgacgtctttgctgatcgcgctggggacgctgctggccatggggctcgtgctccggttt
tgcaggttctcggtgatgcagaagctgttccctcccatccctcacatgaaagaccatatc
aatggcaaacttcagaacggaaggacgatgacctgggaccccgaccaagacagccaggag
gagtgtccagtggccgaggtgcaggttctgggggaaacatga

KEGG   Delphinapterus leucas (beluga whale): 111168273
Entry
111168273         CDS       T05885                                 

Gene name
CSF2RA
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111168273 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111168273 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111168273 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168273 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111168273 (CSF2RA)
   04090 CD molecules [BR:dle04090]
    111168273 (CSF2RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111168273 (CSF2RA)
CD molecules [BR:dle04090]
 Proteins
  111168273 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 111168273
NCBI-ProteinID: XP_022417619
UniProt: A0A2Y9M653
LinkDB
Position
Unknown
AA seq 430 aa
MWERQAAAWRNTALSRPSVNPLCALAMAVLLSMLLVPSLFLTQDQWDKHLPTVEQNSSLN
MKFDPKTTKLTWDCQENTTYGECVLIHKEKGQIKKKVKDKECQCTFQDCSLHGGVTLTVE
VNINQRRISETLVYLNPGGEGTAAQNFSCLIYNADFMNCTWAKGQAAPNDVQYFLYIRDS
KKKIERECPHYLKDSGTHVGCHLQDLSGLTSYSYFLVNGTSQEAGIQFFDSVLLLKEIEQ
YNPPNNITVHCNESHCFIRWEKPRTRKTLSIREFQYQLDIQRQSNTGSSRNQLIVVSGDT
GNKYSFPRPGLRAKHTVKIRTADARKAHWGAWSQPAEFGSAEPESSLVHVYLLVVLGTFI
CGLTISCLFKRFLGMHRLFPPIPRIKDKLNDSHQIDHQQILWEKFAHDVGKGDKEEVLAV
EEVAEAPANA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgtgggagcgtcaggcagcagcatggaggaacacagcactttcacgtccctcggtcaac
cccctgtgtgccctggcgatggccgttctactctccatgctgctggtaccctcactcttc
ctgacccaggaccaatgggataaacatcttccaaccgtggaacagaactccagtctaaac
atgaagtttgacccaaagacgacaaaattaacttgggactgccaggaaaacactacctac
ggggaatgtgtgttgattcacaaggagaagggacagattaaaaaaaaggtcaaagacaag
gaatgtcagtgcacctttcaggactgttctctccatgggggagtcacgctcactgtcgaa
gtaaatatcaaccaaagacgaatttcagaaacactggtctacctgaacccaggtggggag
ggcacagctgcccaaaacttctcctgtcttatctacaatgcggatttcatgaactgcacc
tgggccaagggccaagcagcgcccaatgacgttcaatattttttgtatataagagactca
aagaaaaaaatagaaagagaatgtcctcattacctaaaagactcgggaacacacgtggga
tgtcacctccaagacctctcgggattaacttcgtacagttacttcctggttaacggtacc
agccaagaagcaggaatccagttcttcgattcggttttgctgttaaaagaaatagagcaa
tacaacccacccaacaatatcaccgtgcactgcaacgaatcacactgcttcatccggtgg
gaaaagcccaggacccgaaaaacactgtccatcagggagttccagtaccagctggacatc
cagagacagagtaataccggaagcagtagaaatcaactgattgtggtgtctggtgacacg
gggaataaatacagctttccgagaccggggctcagagccaaacatactgtgaagatcagg
acggcagatgcccggaaagcccactggggtgcctggagtcagccagctgagtttggctct
gcggaaccagaatccagcctggtgcacgtctacctgctggtggtcctggggaccttcatc
tgtggcctgaccatcagctgccttttcaaaaggttcctagggatgcacaggttattcccg
ccaattccacggatcaaagacaaattgaacgatagccatcaaatcgaccaccagcagatc
ctctgggagaaatttgcacatgacgtgggaaaaggtgacaaggaagaggtcttagccgtg
gaagaagtcgcagaagcaccagcgaatgcgtga

KEGG   Delphinapterus leucas (beluga whale): 111168275
Entry
111168275         CDS       T05885                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111168275 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111168275 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111168275 (CRLF2)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111168275 (CRLF2)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 111168275
NCBI-ProteinID: XP_022417623
UniProt: A0A2Y9MKD8
LinkDB
Position
Unknown
AA seq 367 aa
MRRIFLPWATSAVFLLGHLMASEETELRETLQLQIINFNFETVKVTWNASEYPGTNLTFL
QKLSSNEAYRPCSKYTLQQGYTAGCLLEVEKDEVLYFSIRNGTHPLLSKSLWISSYLKPR
SLSDLSFQWHQGAVTVTCSDLWYKGLVYEIQHKSTFDAEWQSKEAKTCNVTLDSLDAEKC
YFFRARVKTLESSYGSDTYPSDWSEVIRQQRGKLTDLCQEKSLFPNFILIAGMVTFLIAS
LLLLPLWKLRRVKKVLMPSVPDPRFTFSGLFESHQGNFQEWIKDTQNVAHVNKMEDGEWE
SIPEEAVVVQLAEMPKTAVTSPVYRQTAEEEATGEPGQLPRQLPQGGEVVSLGDVTFVMS
DNSYVMF
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaggcgtatctttctgccctgggcaacctcagctgtcttcctgctgggacatttgatg
gcttcagaagaaacggagctgagagaaacattgcagcttcaaatcatcaactttaatttc
gaaactgtgaaggttacatggaatgcaagtgaataccccgggactaatttgacattcctc
caaaagttaagcagcaatgaggcatacagaccatgctccaagtatacccttcagcaaggt
tacactgccgggtgcctcttggaagtagaaaaagatgaagttctatatttttccatcagg
aatggaacacacccccttctcagcaagagtctgtggatcagcagttacctgaaacccaga
tccctgagtgatctgagcttccagtggcatcagggagcagtgacagtgacttgctctgac
ctgtggtacaaaggtctcgtgtatgaaatccagcacaagagcacctttgacgccgagtgg
cagtccaaggaggcaaaaacctgcaatgtcacgcttgacagtttggatgctgagaagtgt
tatttctttcgggccagagtgaaaacgctggagtccagctacggctctgacacataccca
agtgactggtcagaggtgatacgccagcagaggggcaagctaacagatttgtgccaggaa
aagagccttttcccaaattttattttaattgctggcatggtcaccttcctgatagcctcc
cttctccttctgcctttatggaaactacggagggttaagaaggttctcatgcccagtgtg
ccggatcccagattcaccttctctgggctctttgagtctcaccaaggtaacttccaggag
tggatcaaggacacgcagaacgtggctcatgtgaataagatggaagacggggagtgggag
tctatcccggaagaggccgtggtggtccagctggccgagatgcccaagacagcggtgacg
agccctgtgtaccggcagacagcggaggaagaggccaccggggagcccggccagctccct
cgccagctcccccagggcggcgaggtggtctctctcggggatgttacgtttgtgatgagt
gacaactcatacgtgatgttctga

KEGG   Delphinapterus leucas (beluga whale): 111168305
Entry
111168305         CDS       T05885                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111168305 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111168305 (IL22RA2)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111168305 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111168305
NCBI-ProteinID: XP_022417661
UniProt: A0A2Y9M9E1
LinkDB
Position
Unknown
AA seq 318 aa
MSHELTKKAQTTPVRNYPPSCRDSCRDSSRECWVPWQALGQFPSTARTIPPEQLCSGTWN
QDAGSLDHNCPDTLACIKIITSKIKNVDFWAPLPPSAPVATISRNPDAETQPAHESLKPQ
RVHFQSQNFHNILHWQPGRACAGNSSIYFVQYKTYGQRQWKNKEDCWGIREFFCDLTNET
SDIWEPYYGRVRTTLAGVHSGWTMTQRFSPWWETKIDPPFMNITQVNGSLLVNLHAPNLP
YRDQKRKNVSMEYYGLVYRVFVINNSLEKEQKVYEGAHRVVEIEALTPHTGYCIVAEMYQ
PTLDRRSQRSQERCVESP
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtcgcatgaattgaccaagaaagcacaaactacgccagtgcgaaattatcccccttcc
tgccgtgactcctgtcgagactcttctcgggaatgctgggttccatggcaagcccttggg
cagtttccctccacagcccggaccattccacctgagcagttatgctcgggcacttggaac
caggatgcaggcagtctggatcacaactgtcctgacactttagcatgcatcaaaatcatc
acatcaaagatcaaaaatgttgatttctgggctccacttccaccatctgcacctgtagca
actatttcaaggaatcctgatgcagaaactcagccagcccacgagtctctgaaacctcaa
cgagtacattttcagtcccaaaattttcacaacattttgcactggcagcctgggcgggct
tgtgccggcaacagcagtatctattttgtgcagtataaaacgtatggacagagacaatgg
aaaaataaagaggactgctggggtattcgagagttcttctgtgaccttaccaatgaaacg
tcagacatatgggaaccttactacgggagagtgaggacgaccctggctggggtccactca
ggctggaccatgacacagcggttctctccctggtgggaaacaaaaatagatcctccattc
atgaatataacccaagttaatggatctttgttggtgaatctccatgctcccaacttacca
tacagggaccaaaaaagaaaaaacgtatcaatggaatactatgggctagtataccgagtc
tttgtaattaacaattcactggaaaaggagcaaaaggtatatgaaggagctcacagagtt
gttgaaattgaagctctaacacctcacactggttactgtatagtggctgaaatgtatcag
cccacattagacagaagaagtcagagaagccaagagagatgtgtggaaagtccttga

KEGG   Delphinapterus leucas (beluga whale): 111169041
Entry
111169041         CDS       T05885                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111169041 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111169041 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169041 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111169041 (IL13RA1)
   04090 CD molecules [BR:dle04090]
    111169041 (IL13RA1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111169041 (IL13RA1)
CD molecules [BR:dle04090]
 Proteins
  111169041 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2 IL4Ra_N
Other DBs
NCBI-GeneID: 111169041
NCBI-ProteinID: XP_022418656
UniProt: A0A2Y9MCB6
LinkDB
Position
Unknown
AA seq 425 aa
MEWPARLCGLWALLLCAGGGGGVAAPAETQPPVTNLSVSVENLCTVTWTWNPPEGASPNC
SLKYFSHFGNKQDKKIAPETYRSKEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPE
GDPESAVTELQCIWYNLSYMKCSWLPGRNTNPDTNYTLYYWHSSLGKVLQCEDIYREGQH
IGCSFALTKVKDSSFEQHSVQVMVKDNAGKIRPSFNIVPLTSHVKPDPPHIKNLSFQNGD
LYVQWKNPQNFYSRCLSYEVEVNNSQAETHDIFYVEEAKCQNSEFEGNLEGTICFMVPGV
LPDTLNTVRIRVKTNKLCYEDDKLWSNWSQAMSIGQKANPTFYITTLLIIPIIVAAAIIV
LLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIESL
KRASQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagtggccggcgcggctctgcgggctgtgggcgctgctgctctgcgccggcggcggc
ggcggggtggccgcgcccgcggaaactcagccacctgtgacgaatttgagtgtgtctgtt
gaaaacctctgcacagtcacatggacatggaatcctcctgagggagccagcccgaattgt
agtctaaagtattttagtcattttggcaacaaacaagataagaaaattgctccagaaact
tatcgttcgaaagaagtgcccctgaatgagaggatttgtctgcaagtggggtcccagtgt
agcaccaacgaaagtgagaagcctagcattttggtggaaaagtgcatctcaccccctgaa
ggcgatcctgagtccgctgttactgaactacaatgcatttggtataacctgagctacatg
aagtgctcttggctccctggaaggaatacaaatcctgacactaactatactctctactat
tggcacagcagcctaggaaaagttcttcagtgtgaagacatctatagagaaggtcaacac
attggttgttcctttgctctgactaaggtgaaggattccagttttgaacaacacagtgtc
caagtaatggtcaaggacaatgcaggaaaaatcagaccatccttcaatatagtgccttta
acttctcatgtgaagcctgatcctccacatattaaaaatctctccttccaaaatggtgac
ttatacgtgcaatggaagaatccacagaatttttatagcagatgcttatcttatgaagta
gaagtcaataacagccaagctgagacacatgacattttctacgttgaagaggccaaatgt
cagaattcagaatttgaaggaaacctagagggtacaatttgtttcatggtccctggtgtt
cttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgctatgag
gatgacaaactctggagtaattggagtcaagcaatgagtataggtcagaaggccaatcca
acattttacataaccacgttactcatcattccaatcatcgttgcagctgcaatcatagtc
cttctactgtacctgaaaaggctcaagattattatattccctccaattcctgatcctggc
aagatttttaaagaaatgtttggagaccagaatgatgataccctgcactggaagaagtac
gacatctatgagaagcaaaccaaagaagaaactgactctgtagtgctgatagaaagcctg
aagagagcctctcagtga

KEGG   Delphinapterus leucas (beluga whale): 111169692
Entry
111169692         CDS       T05885                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04072  Phospholipase D signaling pathway
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05163  Human cytomegalovirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111169692 (PDGFRA)
   04014 Ras signaling pathway
    111169692 (PDGFRA)
   04015 Rap1 signaling pathway
    111169692 (PDGFRA)
   04630 JAK-STAT signaling pathway
    111169692 (PDGFRA)
   04020 Calcium signaling pathway
    111169692 (PDGFRA)
   04072 Phospholipase D signaling pathway
    111169692 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    111169692 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111169692 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169692 (PDGFRA)
   04540 Gap junction
    111169692 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111169692 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169692 (PDGFRA)
   05206 MicroRNAs in cancer
    111169692 (PDGFRA)
   05230 Central carbon metabolism in cancer
    111169692 (PDGFRA)
   05231 Choline metabolism in cancer
    111169692 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    111169692 (PDGFRA)
   05218 Melanoma
    111169692 (PDGFRA)
   05215 Prostate cancer
    111169692 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111169692 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111169692 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111169692 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111169692 (PDGFRA)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111169692 (PDGFRA)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111169692 (PDGFRA)
CD molecules [BR:dle04090]
 Proteins
  111169692 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 111169692
NCBI-ProteinID: XP_022419778
UniProt: A0A2Y9MC65
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHWALLVLGCLVTGPSLILCQLSLPSILPSENERVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRDEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQLEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLGSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVITCAVFNN
EVVDLQWTYPGQVKGKGITMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPRIAWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFQLLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSMVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRVLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcgtcacagggccaagcctt
atcctctgccagctttccttaccctccatcctgcccagtgaaaacgagagggttgtgcag
ctgaattcctccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagagacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagcgcctcggcggcccacacagggctgtacacttgc
tattacaatcacacgcagttggaagaaagcgagatcgagggcagacgcatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattacttggtcatcgtg
gaggacgatgattctgccatcatcccttgtcgaacgactgatcctgagacaccagtgact
ttactcggcagtgacggggtggtgcacgcctcctatgacagcagacaaggcttcaatgga
accttcactgtcggaccctatatctgcgaggccaccgtcagggggaagaagttccagacc
atcccattcaatgtttatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtctataaggcaggggaatcgattgtgatcacctgcgctgtctttaacaat
gaggttgtggaccttcagtggacttaccctggacaagtgaaaggcaaaggcatcacaatg
ctggaggagaccaaggtcccgtccatcaagctggtgtacactctgatggtccctgaggcc
acggtgaaagatagtggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtgcatgagaaagggtttattgaaatcaaacccaac
ttcagcccgttggaagccgtcaacctgcatgaagtcaaacattttgtggtggacgtgcag
gcctacccccctcccaggatagcctggctcaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgagctaaggaagaagacagtggccattatactattgtagttcaaaatgaagac
gatgtgaagagctatacttttcaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaatgggggccagacagtgagatgcacagctgaaggaacc
cctcttcctgatattgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagcatggtggagggccaagtgacattcgccaaagtggaggagaccattgcagtacga
tgcctggctaagaatctcctcggggtggagagccgagagctgaagttggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgttgttggtgattgtaatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcaactg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggc
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagtcggtcccaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagcc
ctcatgtccgagctgaagataatgacccacctggggccgcatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcttgagccgccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctgctgacgaaagcacacgaagttac
gttattttatcttttgaaaacaacggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggaaaggaaagaggtttctaagtactcagacatccagagagtg
ctgtatgatcgcccagcctcatataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggcc
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtcaaaaggcagcacctttctcccggtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttccctcggtggtacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgtatg
cgcgtggactccgacaatgcgtacattggcgtcacctacaaaaacgaggaggacaagctg
aaggactgggagggtggccttgacgagcagaggctgagcgcagacagtggctacatcatc
cctctgcctgacattgaccctgttcctgaagaggaagacctgggcaaaagaaacagacac
agctcgcagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggacctggtggaagacagcttcctgtaa

KEGG   Delphinapterus leucas (beluga whale): 111174176
Entry
111174176         CDS       T05885                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha isoform X1
  KO
K05067  interleukin 5 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111174176 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111174176 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111174176 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174176 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111174176 (IL5RA)
   04090 CD molecules [BR:dle04090]
    111174176 (IL5RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111174176 (IL5RA)
CD molecules [BR:dle04090]
 Proteins
  111174176 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Tissue_fac LIFR_D2 Il13Ra_Ig EpoR_lig-bind
Other DBs
NCBI-GeneID: 111174176
NCBI-ProteinID: XP_022428229
UniProt: A0A2Y9N555
LinkDB
Position
Unknown
AA seq 417 aa
MAPASLILLGATVILQVDLLPDKKFLLLPPVNFTIKAINLAQVLLRWEPNTDQEQRNVQL
GYHVKINAPQEEDYETRNTESRRITILHKGFSASVQTVPWNDRSLQPSSWVSAELRAPPG
SPGTSIVNLTCTTNTKANNYTHLRPYQVSLHCTWLVGKDAPEDTQYFLYYRYGSWTEECQ
EYSKDTLQRNIACWFPRTFINSKGRDLLAVYVNGSSEEAVIKPFDELFALHAIDRVNPPA
KVTAEIEGTCLSIQWEKPVSAFPVHCFDYEVKIYNTRKGYFQTEKMTTNTFISVIDGISE
YSIQVRAAVSSVCRAVGPSSEWSQPIYVGNDEQKPWTKWFLIAVMATICFILLIFSLICR
ICHLWTKVFPPVPAPKSNIKEFFVTINYEKTGSSETETEVISYAEEAGSETLEDSVF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcacctgcatcactgattcttttgggggccacagtgatactgcaagtagacttactt
cctgataaaaaatttttacttctcccacctgtcaatttcaccattaaagctatcaattta
gctcaagttcttttacgctgggaaccaaatactgatcaagaacaaagaaatgtccagcta
gggtatcatgtgaaaataaatgctccacaagaagaagattatgaaaccaggaacactgag
agcagacgcataaccatccttcataaaggcttttcagcaagtgtgcagacggtcccgtgg
aacgaccgctccctccagccaagcagctgggtttccgcggaacttagagccccaccaggg
tctcctggaacctcaattgtgaatttaacttgcaccacgaacaccaaggcaaataattac
acacacttacggccgtaccaagtttctcttcactgcacctggcttgttggcaaggatgcc
cctgaggatacgcagtattttctctactataggtatggctcttggactgaagaatgccaa
gaatacagcaaagacaccttgcagagaaatatcgcctgctggtttcccaggacttttatc
aatagcaaagggcgcgacttgcttgcagtgtatgttaacggctcaagcgaggaagctgtg
atcaagcctttcgatgagctctttgcccttcatgccattgatcgagtaaatcctccagca
aaagtcacagcagagattgaaggaacctgtctctctatccaatgggagaaaccagtttct
gcttttccagtccattgctttgattacgaagtgaaaatttacaacacaaggaaagggtat
tttcagacagaaaaaatgacgaccaatacattcatctccgtaattgatggtatttctgag
tattccattcaagtgagagcagcagtgagctctgtgtgcagagcggtgggaccctccagt
gagtggagtcagcctatttatgtgggaaacgatgagcagaagccctggacaaaatggttc
cttattgcagttatggcaaccatctgcttcatcttgttgattttctcactcatctgcaga
atatgccacttatggaccaaggtgtttccacctgttccggcaccaaagagtaatattaaa
gaattctttgtaaccatcaactatgagaaaactggttccagtgaaacagaaactgaagtc
ataagctatgcggaggaggctggatctgagaccctggaggactctgtgttctga

KEGG   Delphinapterus leucas (beluga whale): 111175412
Entry
111175412         CDS       T05885                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111175412 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111175412 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111175412 (MPL)
   04090 CD molecules [BR:dle04090]
    111175412 (MPL)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111175412 (MPL)
CD molecules [BR:dle04090]
 Proteins
  111175412 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 111175412
NCBI-ProteinID: XP_022430686
UniProt: A0A2Y9NCN1
LinkDB
Position
Unknown
AA seq 645 aa
MPSWALLVVISCLLPAPQNMAQVTSQDASLLASDSEPLNCFSRTFEDLTCFWDEEEAAPS
EIYQLLYAYPGEKPRACPLSSQRVLPFGTRYVCQFPAQDEVRLFSQLHLWVKNVFLNQNL
TQRVLSVDSVGLPGPPSLIKAMGGSQPGELQISWEVPAPEISEFLRHELRYGPKDPRNST
GPTVTLLLSTETCCPALRRPNLAPAPDQSPCAQPMMPQQDVPEQTPTTREAPSLTVKGGS
CLISGLQPGNSYWLQLRSQPDGVSLRGSWGSWSLPVTVDLPGDAVELGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRAWCCPRDRDPVWEKCEEQKKNPGSQPSQFSRCHFKSRNDSA
IHILVEVTTAQGAIHSYLGSPFWIHQAVLIPTPNLHWREVSSGQLELEWQHPSPWAAQET
CYQLRYTGEGHQDWKVLEPPLGAQGETLELRPRSRYRVQLRARLHGPTFHGPWSAWSDPV
KVETASETAWIFLVTALLLVLGVSALLGLLLLRWQFPAHYRSLRHALWPSVPDLHRVLGQ
YLRDTAALSPPKAAASDACEEVEPSLLEIVPRSSEKTPLPLCSSQAQMDYRGLQPSCLGT
MPLSVCPRMAETGSYCTTHIANHSYLPLSCWQAPRSQYPGHIQTL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttggtggtcatctcctgcctcctcccagccccccaaaacatg
gcacaagtcaccagccaagatgcctccttgctggcctcggactcagagcccctgaactgt
ttctcccgaacatttgaggacctcacttgcttctgggatgaggaagaagcagcacccagt
gaaatatatcagctgctgtatgcctacccgggggagaagccccgtgcctgccccctgagt
tcccagcgtgtgctgccctttggaacccggtacgtgtgccagtttccagcccaggatgaa
gttcgcctcttctctcaactgcacctctgggtgaagaacgtgtttctgaaccagaatctg
acccagcgggtgctctctgtggatagtgtgggcttgccaggtccccccagcctcatcaag
gccatgggagggagtcagccaggggaacttcagatcagctgggaggtcccagctcccgaa
atcagtgaatttctgaggcatgaactccgctatggccctaaggatccaaggaactccact
ggtcccacagtcacactgctgctgtccacagaaacctgctgcccagctctgcggagacca
aacctagccccagctccggaccagtctccatgtgctcagcccatgatgccccaacaggat
gtaccagagcagacccccacaactagagaagctccatctctgacagtgaagggtggaagc
tgcctcatctcagggctccagcctggtaactcctactggctccagctacgcagccaacct
gatggggtctccctccgtggctcctggggatcttggtccctccctgtgaccgtggacctg
cctggggatgcagtggaacttggactgcaatgctttaccttggacctgaagaatgttacc
tgtcagtggcagcaacaggaccatgctagctcccaaggcttcttctaccacagcagggca
tggtgctgccccagagacagggaccccgtctgggagaagtgtgaagagcagaagaaaaat
ccaggatcacagccctcccagttctcccgctgccacttcaagtcacgaaatgacagtgct
attcacatccttgtggaggtgaccacagcccagggtgccattcacagctacctgggctcc
cctttctggatccatcaggctgtgctcattcccactccaaacttacactggagggaggtc
tccagcgggcagctggaactggaatggcagcatccatcaccctgggcagcacaagagacc
tgctatcagctccgatacacaggagaaggccatcaggactggaaggtgctggagccgcct
ctcggggcccagggagagaccttagagctgcgcccgcgctcccgctaccgtgtacagttg
cgcgccaggctccacggccccaccttccatgggccctggagcgcctggtccgacccagtg
aaggtggaaaccgcctccgagaccgcctggatctttttggtgaccgctctgctcctggtg
ctgggcgtcagcgccctcctgggcctgctgctgctgaggtggcagtttcctgcgcactac
aggagcctgaggcatgccctgtggccctcagttccagacctgcaccgggtcctaggccag
taccttagggatactgcagccctgagtccgcccaaggctgcagcctcagatgcctgtgag
gaagtggaacccagcctccttgaaattgtacctaggtcctcagagaagactcccttgccc
ctatgttcctcccaggcccagatggactaccgaggattgcagccttcttgcctggggacc
atgcccctgtctgtgtgcccacgcatggctgagacagggtcctactgcaccactcacatc
gccaaccattcctacttaccactcagctgctggcaggcccctcgctcccagtaccctgga
cacatccaaaccctctag

KEGG   Delphinapterus leucas (beluga whale): 111175589
Entry
111175589         CDS       T05885                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111175589 (CSF3R)
   04151 PI3K-Akt signaling pathway
    111175589 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111175589 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111175589 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175589 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111175589 (CSF3R)
   04090 CD molecules [BR:dle04090]
    111175589 (CSF3R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111175589 (CSF3R)
CD molecules [BR:dle04090]
 Proteins
  111175589 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig
Other DBs
NCBI-GeneID: 111175589
NCBI-ProteinID: XP_022430963
UniProt: A0A2Y9NNS8
LinkDB
Position
Unknown
AA seq 846 aa
MAGLGAWNLARAALIILLLPRSLEQCGHISLSAPIVRLGDPITASCTISQNCSRLDSESH
IVWKLEAELQPGERQQYLPNGTLLSTITLPHLNRSRALLSCCLHWGNSLQILDQAELQAG
YPPATPHNLSCLMNLTTNSLTCQWEPGPNTHLSTNFTLKSFKSRGNCQSREDSIPDCVPE
DGQSHCSIPRKHLQLYQNMGIWVQAKNALGTSVSPKLCLVPMDVVKLEPPTLWARGPSPE
VAPPQPGCLRLRWETWKPSLHIDQKCELRHQPLLGEASWDLVGALPSRTLQYELCGLLPS
TAYALQMRCTRWRLPGHWSNWSPSLELTTTQRAPTVRMDTWWRQRQLDPRTVDVQLFWQP
VPLEEDSGQIQGYLVLRPSDQAGADPMLCNTTELNCTFQLPSEAREVILEAYNTAGTSHP
TPVVFLESGGPPLGRLHTVARDPHSLWVGWEPPSPQPRGYVIEWGLGPPSPSGSPKTWRM
EHNGSIAGTLLQENIRPFQLYEITVTPLYQDTKGPSQHIYAYSQEMAPSHGPELHLRHIG
KTWAQLEWVPEAPELGRSPLTHYTIFWTNAQDRSFSTVLNASSHSFVLRGLEPSSLYHVH
LMAASQVWATNSTSLTLMTLALGFPLTLEESELHILLGLFGLLVLLICLCGAAQLCCRPS
RKNPLWPSVPDPAHSSLGSWVPTITTEDTFQLPSLRDSSMPPITKITVLEEEEKKPGPWE
SNDSSGTCGLPSLVQAYVLQGDPRVPRIQPQPQSGTSDQVLYVQVLGSPTGPRPGHYLRC
DSTQPLLGGLTPSPKSYENLWFQTSPLGTPEPLVPNPEDDCIFEPLLDFPLLQGLRVSGV
EGLGGF
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggcggggctgggagcctggaacctagcgagagctgctctgatcatcctgctgctcccc
agaagcctggagcagtgcgggcacatcagcctctcagcccccatcgtccgcctgggggat
cccatcacagcctcctgcaccatcagccagaactgcagccgcctggactcggaatcgcac
attgtatggaagttggaagcagagcttcagcccggggagaggcagcagtacctgccgaat
gggaccctgctgtccaccatcaccttgccccacctcaaccgctctcgggcccttctctcc
tgctgcctgcactggggcaacagcctgcagatcctggaccaggctgagctacaggcaggc
taccctcccgccacaccccacaacctgtcctgcctcatgaacctcacaaccaacagcctc
acctgccagtgggagccaggccccaacacccacctgtccaccaacttcaccctgaagagc
ttcaagagccggggcaactgtcagagccgggaggactccatccccgactgcgtgcctgag
gacgggcagagccactgctccatcccccgcaaacacctacagctgtaccagaacatgggc
atctgggtgcaggccaagaacgcgctgggaaccagcgtgtccccgaagctgtgccttgtc
cccatggacgttgtgaaactggagccccccacactgtgggcccgggggcccagccctgag
gtggccccaccgcagccaggctgcctgaggttgcgctgggagacctggaagccaagccta
cacatagatcagaagtgtgagctgcgccaccagcctctgcttggagaagccagctgggac
ctggtgggcgccctgccctccaggaccctccagtatgagctatgcgggctcctcccatcc
acagcctatgccctgcagatgcgctgcacccgctggcgcctgcctggccactggagcaac
tggagccccagcctggagctgaccaccacacaacgggcccccactgtcagaatggacaca
tggtggcggcagaggcagctggaccccaggacggtggacgtgcagctgttctggcagcca
gtgcccctggaggaagacagcgggcagatccaagggtacctggtcttgagaccctcagac
caggctggggcagacccaatgctctgcaacaccacggagctaaactgtaccttccaactg
ccttcagaagcccgggaggtgatccttgaggcctataacacagctgggacctctcatccc
accccagtggtcttcttggagagcggaggcccacccctgggcagactccacaccgtggct
cgagaccctcacagcctctgggtgggctgggagccccccagccctcagcctcggggctat
gtcattgagtggggcctcggtccccccagccccagcggcagccctaagacgtggcggatg
gagcataatggaagcattgcagggaccctgctgcaggagaacatcaggccctttcagctc
tatgagatcactgtgacccccctgtaccaggacaccaaaggaccctcccagcacatctat
gcttactcccaagagatggccccctcccatggcccagagctgcatctaaggcacattggc
aagacttgggcccagctggagtgggtacccgaggcccctgagctggggaggagccccctt
acccactacactatcttctggaccaatgctcaggaccggtccttctccactgtcctgaac
gcctcctcccatagctttgtcctccgtggcctggagccttccagcttgtaccatgtccac
ctcatggctgccagccaggtgtgggccaccaacagtacaagcctcaccctgatgaccttg
gccctaggctttcccctcactctagaggagtctgagctgcacatcctcctgggcctcttt
ggcctcctggtcttgctcatctgcctctgtggggctgcccagctctgctgcagacccagc
aggaagaatcccctctggccaagcgttccagacccagcccacagcagcctgggttcctgg
gtgcctaccatcacaacggaggataccttccagctgcccagccttcgggactccagcatg
ccacccatcaccaagatcacggtgctagaggaggaagagaagaagccaggaccctgggag
tccaatgacagctcagggacctgtggcctccccagcctggtccaggcctatgtgctccag
ggggacccaagagtacctcgtatccagccccagccccagtctggcaccagtgaccaggtc
ctttacgtgcaggtgctgggcagccccacaggcccacggcctgggcactacctccgctgc
gactccactcagcccctcttggggggcctcacccccagccccaagtcctatgagaacctc
tggttccagaccagccccctggggaccccagagcccctagtcccaaacccggaggatgac
tgtatctttgagccactgcttgacttccctctcctgcaggggctccgggtcagtggggtg
gagggtctcgggggcttctag

KEGG   Delphinapterus leucas (beluga whale): 111177976
Entry
111177976         CDS       T05885                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X1
  KO
K05074  interleukin 15 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04672  Intestinal immune network for IgA production
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111177976 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111177976 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    111177976 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177976 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177976 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111177976 (IL15RA)
   04090 CD molecules [BR:dle04090]
    111177976 (IL15RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111177976 (IL15RA)
CD molecules [BR:dle04090]
 Proteins
  111177976 (IL15RA)
SSDB
Motif
Pfam: Sushi Herpes_glycop DUF5534
Other DBs
NCBI-GeneID: 111177976
NCBI-ProteinID: XP_030617631
LinkDB
Position
Unknown
AA seq 292 aa
MSGRLRGCGVGALPALLLLLLLGPPATPGITCPTPTSVKHADIWVKSYNLNSRERYVCNS
GFKRKAGTSSLTECVFNKTVNIAHWTTPNLKCIKPAFTSRSDTTVATRLATGPGSRLMPS
KAPSAGTTAVVNNEPSQVPAQTTAKAPEHTPSASQDPPGAYQYNPRAVTAAISTSVAVLC
GVCVVCLLVRYVRYIRSRQAYQIPSVEMESMEVVPMTGGTDARGEGTENESHDPEGSKGT
TRAAKATVKAQLCSSQRGPREALGRWPRGKAHQGEKTSWYHFTDCPAQAPPV
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtcggggcggctccggggctgcggggtcggcgccctccccgcgctgctgctgctgctg
ctgctcggaccgccggcgacgccgggcatcacgtgcccaactcccacatctgtgaaacat
gcagacatctgggtcaagagttacaacctcaactccagggagcggtatgtttgtaactct
ggcttcaagcgtaaagctgggacctccagcctgaccgagtgcgtgtttaacaagactgtg
aacatcgcccactggaccactcccaatctcaagtgcatcaagccagcttttacttccagg
tcagacaccacagtggccacaaggctggctactggaccaggctccaggctgatgccatcc
aaagctccttctgcggggaccacagcggtagtcaataatgagccctcccaagtcccagct
cagacaacagccaaggctccggaacacaccccctcggcctcgcaggacccgcccggtgca
tatcagtacaatcccagagctgtgactgcggccatctccacgtcagtcgccgtgctctgt
ggagtgtgcgtggtatgtcttctggtacgttacgtacgttacatacggtcaaggcaagct
taccagatacccagtgttgaaatggaaagcatggaggtcgtgccaatgactgggggaacc
gacgccagaggggagggcacagaaaacgaatcacacgacccagaaggctccaaggggacg
acgagggcagcaaaagccacagtgaaggcccagctctgctccagccaaagaggacctaga
gaagccttggggcggtggcctcggggaaaagcccaccagggtgagaaaacatcctggtac
cattttaccgactgcccagctcaggcaccgcccgtatga

KEGG   Delphinapterus leucas (beluga whale): 111177977
Entry
111177977         CDS       T05885                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111177977 (IL2RA)
   04151 PI3K-Akt signaling pathway
    111177977 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111177977 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111177977 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111177977 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111177977 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    111177977 (IL2RA)
   04659 Th17 cell differentiation
    111177977 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177977 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177977 (IL2RA)
   05162 Measles
    111177977 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111177977 (IL2RA)
   04090 CD molecules [BR:dle04090]
    111177977 (IL2RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111177977 (IL2RA)
CD molecules [BR:dle04090]
 Proteins
  111177977 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 111177977
NCBI-ProteinID: XP_022435933
UniProt: A0A2Y9P1F6
LinkDB
Position
Unknown
AA seq 275 aa
MEPGLLMWGFFVFIVVPGCVTDVCLEDPPSLRNAMFKVLRYEVGTMINCDCKKGFRRRSP
FMRCTGNSSHSAWENRCHCDSTSSPKTPGKQVTPGLKDEEKTTEMQSQMQPTGQANLPGH
CKEPPPWEHEREPLKRIYHFMAGQTVYYQCTQGFRALQGGPTKSTCKMIYGNMRWTQPKL
GCISDRENSQFPGDEEPQESTDAPPGSETSFPLTTRMAGTTDFQTPTEVAATMDTFIFTT
EYQIAVAGCILLLISIFLLTGLTWQQKWKKKRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagccaggcttgctgatgtggggattctttgtattcatcgttgtacctggctgcgtg
acagatgtttgtcttgaagacccaccgagtctcagaaacgccatgttcaaggtcctcagg
tatgaggtgggcaccatgataaactgtgactgcaagaaaggcttccgcagaaggtcgccc
ttcatgcgctgcacaggaaactccagccactctgcctgggaaaacagatgccactgcgac
agcacctcctcccctaagactccaggaaaacaagttactcctggactcaaagatgaagaa
aagaccacagaaatgcagagccaaatgcagcccacaggccaagctaaccttccaggtcac
tgcaaggagcctccaccatgggaacatgaacgtgaacctttgaagagaatttaccatttc
atggcggggcagacagtttactaccagtgcactcagggattcagggccctacagggaggc
cctaccaagagcacctgcaagatgatctatgggaacatgaggtggacccagcccaagctt
gggtgcataagtgacagggagaacagtcagtttccaggtgatgaagagcctcaggagagc
acggatgctccccctggcagtgaaacgtcttttcccttaacaacgaggatggcaggtacc
acagatttccaaacacccacagaagtggctgcgaccatggatacgttcatatttacaacc
gagtatcagatcgcagtggccggctgcatcctactgctcatcagcatcttcctcctgacc
ggcctcacctggcagcagaaatggaagaagaaaagaaggacaatctag

KEGG   Delphinapterus leucas (beluga whale): 111178439
Entry
111178439         CDS       T05885                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178439 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111178439 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111178439 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178439 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111178439 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111178439 (IL12RB2)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111178439 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind
Other DBs
NCBI-GeneID: 111178439
NCBI-ProteinID: XP_022436841
UniProt: A0A2Y9P0N5
LinkDB
Position
Unknown
AA seq 861 aa
MAHTVNGCPLALTFIIVWLLVKAKIDVCKRGDVTVQPSHVISLGSAVNISCSLKTKQGCV
QFSSFNKLILYKFDRRIYFQHGHSLSSQVTGLPLGTTLFVCKLACSSNDEIRICGAEISV
GVVPEQPQNLSCIQKGERGTVRCTWDRGQDTHLYTAYTLQLKGPKNLTWQKQCNDHYCDH
LDLGINLTPESPESSYTAKVTAINSLGSASSFPSSFTLLDIVRPLPPWDIRIKFVNASVS
RCTLQWRDEGLVLLNRLRYRPINSRSWNMVNATNAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRTQTPEEEPTGTLDVWYMRQHIDYNRQQISLFWKNLSLSEAKGKILHY
QVTLQEVAGGKATLQNITEHTSWTWVIPRTGNWAVSVSAANSKGSSLPTHVNITDLCGAG
LLAPQQVSANSEGVDNLMVTWTPPGKAAAAVQEYVVEWRELHPGASTQPPLGWLWSPPYN
LSALISENIKPYICYEIRVHALSGDQGGCNSIRGNSKHKAPLSGPHINAISEEKGSILIS
WNEIPAREQMGCILHYRIYWKEQDSNSQPQLCEIPYRVSPNPHPIDSLRPRVTYILWMTA
LTAAGESPQGNEREFCLQGKANWSTFVAPSICMGVIMVGVLSVRCFRQKVFVLLLALRPQ
WCSKEIPDPANSTWAKNYPIVEEKTQLALDRLLTDCPTPEEPETLVINKVLHQVTPAFRR
SHHPNWPEKGQGVQGHYTSEEDTGYSASSPPPPRALTAETGQGVDLYKVLGSKGPDSTPG
NPASPSTVLPVDYLPAYEGYLPSNIDYLPSHEPSITDPREELPQHISLSIFPSSSLHPLT
SSCGEKLTLDQVKMGCGSLML
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcacatacagttaacgggtgcccattggcacttacttttatcatcgtgtggctgtta
gttaaagcaaaaatagatgtgtgcaagagaggggatgtgactgtgcagccttcccatgta
atttcacttgggtcagctgtcaacatttcgtgctctttgaagaccaaacaaggctgcgtg
caattctccagttttaacaagttaatcctctacaagtttgacagaagaatctattttcag
catggtcactcactcagctcacaagtcacaggtcttcccctgggtacaaccctgtttgtc
tgcaaactggcctgtagcagtaatgacgagattcgaatatgtggggcagagatctccgtt
ggtgttgttccagaacagcctcaaaacttatcttgtatacagaagggagaacgtgggacc
gtgagatgcacctgggatagaggacaagacacccacctgtatactgcctatactttacag
ttaaagggaccaaaaaatttaacttggcaaaagcaatgtaatgatcactattgtgatcat
ttggaccttggaattaacctaacccctgaatcacctgaatctagttacacagccaaggtt
actgctatcaatagtcttgggagtgcttcttcattcccatcctcattcacattgttggac
atagtgaggcctcttcctccgtgggacatcagaatcaaatttgtaaacgcttccgtgagc
aggtgtacccttcagtggagagatgaggggctggtgctgcttaatcgactcagataccgg
cccattaacagcaggtcctggaatatggttaatgccacaaatgccaaaggaagacatgat
ttgctggatctgaaaccctttacagaatatgaatttcagatttcctctaagttacatctt
tataaaggtagttggagtgattggagtgaatcactgagaacacaaacaccagaagaagag
cctactggaacattagatgtctggtacatgagacagcacattgactacaatagacaacag
atttctcttttctggaagaatctgagcctatcagaggcaaaaggaaaaatcctccactat
caagtgaccttgcaggaggtagcagggggaaaagccacactacagaacatcacagaacac
acctcctggacctgggtcattcccagaactgggaactgggctgtgtccgtgtctgcagct
aactcgaaaggcagttccttgcccactcatgttaacataacagacctgtgtggggcaggg
ttgctggctcctcaacaggtctcagcaaactcagagggcgtggacaacctcatggtgaca
tggacacctccagggaaagctgccgctgctgtgcaggagtatgtggtggaatggagggaa
ctccatccgggggccagcacgcagccccctctaggctggttgtggagtcccccctacaac
ctgtctgctctgatttcagaaaacataaaaccctacatctgttatgaaatccgtgtgcat
gcactttcaggggaccagggaggatgcaactccatccggggtaactctaaacacaaagca
ccactgagtggcccccacattaatgccatctcagaggaaaaagggagcattttaatttca
tggaacgaaattccagcccgggagcaaatgggctgcatcctccattacaggatatattgg
aaggaacaggactccaattcccagcctcagctttgtgaaattccctatagggtctcccca
aatcctcatcccatagacagcctgcggcccagagtgacatacattctatggatgacagct
ctgacagctgctggtgaaagcccccaaggaaatgaaagagaattttgtctgcaaggtaaa
gccaattggagcacatttgtggcaccaagcatttgcatgggtgtcatcatggtgggcgtt
ctctcagtgcgttgcttccggcaaaaggtatttgttctccttttggccctcagacctcag
tggtgtagcaaagaaattccagacccagcgaatagcacttgggccaagaactatcccatt
gtggaggagaagacgcagctggccttggataggctcctgacagactgtcccactcccgag
gaacctgagaccctggtcatcaacaaagtccttcaccaagtgaccccagccttcagacgt
tcccatcaccccaactggccagaaaagggacaaggagtccaaggtcactatacctctgag
gaagacacaggatacagtgcctcgagccccccacctccgagagctctcacagcagagaca
ggacaaggggtggatctgtacaaggtgctggggagcaagggccccgactcaacaccagga
aacccagccagcccctcgacagtcctcccagtggactaccttcctgcctatgagggctac
ttaccctccaacatagattatctcccttcacatgagccttccataactgaccctcgggaa
gaactgcctcagcacatctctctttccattttcccctcgagttcccttcacccactcacc
tcctcctgtggtgagaagttgactctggatcaggtaaagatggggtgtggctccctcatg
ctctga

KEGG   Delphinapterus leucas (beluga whale): 111178441
Entry
111178441         CDS       T05885                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178441 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111178441 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111178441 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178441 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111178441 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111178441 (IL23R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111178441 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Lep_receptor_Ig IL12p40_C Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 111178441
NCBI-ProteinID: XP_022436853
UniProt: A0A2Y9P3V8
LinkDB
Position
Unknown
AA seq 630 aa
MNQVTIQWDVAIALYVFFNWCHGGITNINCSGRIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLYFYKNGIKERFQITRINKTTACLWYNNFQEPQAFMYCTAECPGYFQETLICGKDIS
SGYPPDVPDKVTCVIYEYSGNMTCTWNPGKPTYIDTKYVVYVQSLETEEEQEYLTSSYVN
ISTDSLQGGKKYLVWVQASNVLGTEKSKQVQIHLDDIVIPSASIISRAEDINTTVPKTII
HWNSQTSIEKVSCEMRYKATTNQTWNVKEFDTNFTYAQQSEFYLQPNTKYVFQVRCQEKA
KRYWQPWSSPFFHKTPEIVPQVTLKSFQHDTQNSGLLIASIFEGHLTSDNRQQDIGLLLG
MVFFAVILSILSLIGILNRSLRTGIKRRILLLIPKWLYEDIPNIENSNVVKMLQEKSEFM
NNNSREQVLYVDPVITEIEIFLPEEKPMDYKREKNTGSVETNDSLQKSLLTNTTIVYIPD
LNTGYKPQVSNFLTGGNHLSNNDETASSTLEPPADCLNLGKNARFKKYPNFSFSVSSMNS
LSNTLFLEELSLILNQGECSPPDMQNPVEGETTMLLENASPNENIPEQTLLPDEFVTCLG
SMNEALPSINSYFPQNILESHFNRISLLEK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcaatgggacgtggcaatagctctttacgtattcttcaattgg
tgtcatggaggaattacaaatataaactgctctggacgcatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaactttatttttataaaaatggcatcaaagaaagatttcaaatcacaagaatt
aataaaacaacggcttgcctttggtataacaactttcaggagccacaagcctttatgtac
tgtactgctgaatgtcctggatattttcaagagacactgatatgtggaaaagacatttct
tctggatatccaccagatgtccctgacaaagtaacctgcgtcatttatgaatattcaggc
aacatgacttgtacctggaaccctgggaagcccacctacatagacaccaagtatgtggtg
tacgtgcagagtttagagacagaagaagagcaagagtatctcacttcaagttatgttaac
atctccactgattcattgcaaggtggcaagaagtatttggtttgggtccaagcttcaaat
gtactgggcacagagaagtcaaaacaagtgcaaattcacctggacgatatagtgatacct
tctgcatccattatttccagggctgaggatataaatactacagtgcccaaaaccataatc
cactggaatagtcaaacatcaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaacgttaaagaatttgacaccaattttacatacgcgcaacagtca
gaattctacttgcagccaaacactaagtatgtatttcaagtaagatgtcaagaaaaagct
aaaaggtactggcagccctggagttcacccttttttcataaaactcctgaaatagttccc
caggtcacactgaaatcatttcaacatgatactcagaattctgggcttctaattgcttcc
atctttgaaggacaccttacttctgacaataggcaacaagacattgggcttctattagga
atggtcttctttgccgttattttatcaattctttctttgattgggatattgaacagatcg
ctcagaactggaattaaaagaagaatcttattgctaataccgaagtggctttatgaagat
attcctaatatagaaaatagcaatgttgtgaaaatgctacaggaaaaaagtgaatttatg
aataataattccagagaacaggtcctatatgttgatccagtgattacggagatagaaatc
tttctcccagaagaaaaacccatggactacaaaagggaaaagaacacaggatccgtggag
acaaacgacagcctgcagaagtcactactcaccaacactacaattgtatatattcctgat
ctcaacactgggtataaaccccaggtttcaaattttctcactgggggaaaccatctcagc
aataatgatgaaacagcttcctcaactctggagccaccagctgattgcttaaacctggga
aagaatgccaggtttaaaaaatatcctaatttttctttctctgtctcaagtatgaattcg
ctaagcaacacactatttcttgaagaattaagcctcattttaaatcaaggagaatgcagt
cctccagacatgcaaaaccctgtagaaggggaaaccaccatgcttttggaaaatgcatca
ccaaatgaaaatattccagaacagaccctgctgcctgatgaattcgtgacctgtttgggg
agcatgaacgaggcgttaccatctataaattcttattttccacaaaatattttggaaagc
cacttcaataggatttcgctcttagaaaagtag

KEGG   Delphinapterus leucas (beluga whale): 111178451
Entry
111178451         CDS       T05885                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04080  Neuroactive ligand-receptor interaction
dle04152  AMPK signaling pathway
dle04630  JAK-STAT signaling pathway
dle04920  Adipocytokine signaling pathway
dle04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178451 (LEPR)
   04152 AMPK signaling pathway
    111178451 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111178451 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    111178451 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111178451 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111178451 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111178451 (LEPR)
   04090 CD molecules [BR:dle04090]
    111178451 (LEPR)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111178451 (LEPR)
CD molecules [BR:dle04090]
 Proteins
  111178451 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 111178451
NCBI-ProteinID: XP_022436906
UniProt: A0A2Y9NSA2
LinkDB
Position
Unknown
AA seq 917 aa
MSYMMSYIWRTMGRFRKSSSCPDVEDKPFLKALSEKFIYVITAFNLAYPITPWKFKLSCM
PRNTTYDFLLPAGISKNTSSLSGHYEALVETKLNSSGTYLSNLSSRTTFHCCFWSEEDKN
CSVHADNIEGKAFVSTVNSLVFQQIGANWNIQCWMKEDLKLFICYMESLFKSPFKNYDLK
VHLLYLLLEVLEESPLLPQKSSFQIVQCNCSVHECCECHVPVPTVKINYTLLMYLKITSG
GVIFHSPPMSVQPINVVKPDPPLGLCMKITDTGNLKISWSSPTLVPFQLQYQVKYSENST
KNMRKADETVSATSLLVDSVLPGSSYEVQVRSKRLDGPGIWSDWSTPLTFTTQDVIYFPP
KILTTVGSNVSFHCIYKNENKIVSSKKIVWWMNLAEKIPQSQYDVVGDHVSKVTFPNLNA
TKPRGKFTYDAVYCCNEHECHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSAIQSLV
GSTLQLRYQRSSLYCSDVPSIHPISEPKDCHLQRDGFYECLFQPIFLLSGYTMWIRINHS
LGSLDSPPTCVIPDSVVKPLPPSSVKAEITVKIGLLKISWEKPVFPENNLQFQIRYGLSG
KKVQWKVFEVYDAKLKSASFPVPDLCAVYAVQVRCKRLDGLGYWSNWSTPAYTIVTDIKV
PIRGPEFWRIINEDNTKKERNVTLLWKPLMKNDSLCSVRRYVVKHHTSRNGTWSEDVGNH
TKFTFLWTEQAHSVTVLAVNSIGASSANFNLTFSWPMSKVNIVQSLSAYPLNSSCVILSW
MLSPSDYNLMYFILEWKILHEDNEIKWLRIPSSVKKYYVHDHFIPIEKYQFSLYPIFMEG
VGKPKIIDSFTQDDEKHQHDAGLYVIVPIIIPSSILLLGTLLISHQRMKKLFWEDVPNPK
NCSWAQGLNFQKRMDIL
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgtcttatatgatgtcatatatctggagaaccatgggcagattcaggaaatcatccagc
tgtcctgatgttgaagacaaaccctttctaaaagcactcagtgaaaaatttatttatgtg
ataactgcatttaacttggcatatccaattactccctggaaatttaagttgtcttgcatg
ccacgaaatacaacatatgacttcctcttgcctgctggaatctcaaagaacacttcaagt
ttgagtggacattatgaggcacttgttgaaactaaacttaattcaagtggtacctactta
tctaacttatcatccagaacaactttccactgttgcttttggagcgaggaagataaaaac
tgctctgtacatgcagacaacattgaagggaaggcatttgtttcaacagtaaattcttta
gtttttcaacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttgaaa
ttattcatctgttatatggagtcattatttaagagtcctttcaagaattatgaccttaag
gtccatcttttatatcttctgcttgaagtattagaagagtcacctctgctcccccagaaa
agcagttttcagattgttcagtgcaactgcagtgttcatgaatgttgtgaatgtcatgtg
cccgtgccaacagtcaaaatcaattacacccttcttatgtatttgaaaatcacatctggt
ggagtaatttttcactcacctccaatgtcagttcagcccattaatgttgtgaagcctgat
ccaccattaggtttgtgtatgaaaatcacagatactggtaatttaaagatttcttggtcc
agcccaacattggtaccatttcaacttcaatatcaagtgaaatattcagagaattctaca
aaaaatatgagaaaagctgatgagactgtctcagctacatctctgctagtagacagtgtg
cttcctgggtcttcgtatgaggttcaggtgaggagcaagagactggatggcccaggaatc
tggagtgactggagcaccccccttacctttaccacacaagatgtcatatactttccacct
aaaattctgacaaccgttgggtctaacgtttcttttcactgcatctataaaaatgaaaac
aagatagtttcctcaaaaaagattgtttggtggatgaatttagctgagaaaattccccaa
agccagtatgatgttgtgggtgaccatgttagcaaagttacttttcctaatttgaatgca
accaaaccccgaggaaagttcacctatgacgcagtgtactgctgcaatgagcatgagtgc
caccatcgctatgctgagttatatgtgattgatgtcaatatcaatatatcatgtgaaact
gatgggtacttaactaaaatgacttgcagatggtcacccagtgcaatccaatcacttgtg
ggaagcactttgcagttgaggtatcagaggagcagcctttactgttctgacgttccatct
attcatcccatatctgaacccaaagattgccacttgcagagagatggtttttatgaatgc
ctatttcagccaatctttctattatctggctatacaatgtggattagaattaatcactcc
ttgggttcactggactctccaccaacatgtgtcattcctgattccgtggtgaaaccactg
cctccatctagtgtgaaagcagaaattactgtaaaaattggattattgaaaatatcttgg
gagaagccagtctttccagagaataatcttcagttccagattcgctatggtttaagtgga
aaaaaagtacaatggaaggtatttgaggtgtatgatgcaaaattaaaatctgccagtttc
ccggtgccagacctgtgtgcagtctatgctgtccaggtgcgctgtaagaggctagatgga
ctgggatattggagtaattggagtactccagcctacacaattgtcacggatataaaagtt
cctatcagaggacctgaattttggagaataattaatgaagacaacactaaaaaagagaga
aatgtcactttgctttggaagcccctgatgaaaaatgactcattgtgcagtgtgagaaga
tatgtggtgaaacatcatacttcccgcaatggaacatggtcagaagatgtaggaaatcac
actaaattcactttcctttggacagagcaagcacactctgttaccgttctggctgtcaat
tcaattggtgcttcttctgcaaattttaatttaacattctcatggcccatgagcaaagta
aatatcgtgcagtcactcagtgcatatcctttaaacagcagttgtgtaattctttcctgg
atgctatcacccagtgattacaatctgatgtattttattcttgagtggaaaattcttcat
gaagacaatgaaattaaatggcttagaatcccttcctctgttaagaagtattatgtccac
gatcattttatccccattgagaagtatcagttcagtctttacccaatatttatggaggga
gtggggaaaccgaagataattgatagtttcacccaagatgatgaaaaacaccagcatgat
gcaggtctatatgtaattgtgccaataattattccctcttccatcttattgcttggaaca
ttgttaatatcacaccaaaggatgaaaaagctgttttgggaagatgttccaaaccccaag
aattgttcctgggcacaaggacttaattttcagaagagaatggacattctttga

KEGG   Delphinapterus leucas (beluga whale): 111179218
Entry
111179218         CDS       T05885                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111179218 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111179218 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111179218 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111179218 (IL20RB)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL10/28 receptor family
   111179218 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 111179218
NCBI-ProteinID: XP_022438275
UniProt: A0A2Y9NZ83
LinkDB
Position
Unknown
AA seq 342 aa
MVLEEIETSLIMWFSYALIPCLLVEEAETLKQARKSLEGQSKRNKEDVAVFSDTFAIRAV
GDGVAVLPAPQNLSVQSTNMKHVLTWSPVIVPEEIIHYSVEYQGEYESLYMSHIWIPSSW
CSPTQGPECDITDDITATVPYSLRVRATLGSLTSAWSTLKHPFNRNSTILTPPGMEITKD
GFHLVIKLEDLGPQFEFFVAYWKREPGAKEHVKMVRRGGIPVHLETMEPGAAHCVKVRTF
VKAIGRHSAFSQTECVKVQGETLPLALALFSFVGFMLILVVVPLSIWKMGRLLQHSCCPV
VMLPDTLKITSSPQKLISCRREEVEACVAAGLSSEALLRAWI
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggttctagaagaaatcgagacaagtcttatcatgtggttttcctacgccttgattcct
tgtttgctcgtggaagaagctgagacgttgaagcaggccagaaaaagtttggaaggacaa
agcaaaaggaataaagaagatgttgctgtgttttctgacacatttgccataagggctgtt
ggagatggagtggctgttctgcctgcccctcagaacctctctgtacaatcaaccaacatg
aagcatgtcttgacatggagcccagtgattgtgcctgaagaaataatacactattctgtc
gagtaccaaggagagtatgagagcctgtacatgagccacatctggatccccagcagctgg
tgctcgcccacccaagggcccgagtgtgacatcactgatgacatcaccgccactgtacca
tacagcctccgggtcagggccaccctgggttcactgacctcagcatggagcaccctgaag
cacccctttaatcgaaactcaaccatcctcaccccacctgggatggagatcaccaaggat
ggcttccacctggttattaagctggaagacctggggccacagtttgagttcttcgtggcc
tactggaagagagagcctggtgccaaggaacacgtcaagatggtgaggcgcgggggcatt
ccggtgcacctggaaaccatggagccaggggctgcacactgtgtgaaggtccggacgttc
gtgaaggccattgggaggcacagtgccttcagccagacagaatgtgtcaaggtgcaagga
gagaccctgccgctggcactggctctgttctcatttgtgggcttcatgctgatcctcgtg
gttgtgccgctctccatctggaaaatgggccggctgctccagcactcctgttgccccgtg
gtgatgctccccgacaccttgaaaataaccagttcaccccagaagctgatcagctgcaga
agggaagaggtagaagcctgtgtggcggccgggctgtcttctgaggcgctcctcagggcc
tggatctag

KEGG   Delphinapterus leucas (beluga whale): 111182213
Entry
111182213         CDS       T05885                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05200  Pathways in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182213 (IL4R)
   04151 PI3K-Akt signaling pathway
    111182213 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182213 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182213 (IL4R)
   04658 Th1 and Th2 cell differentiation
    111182213 (IL4R)
   04659 Th17 cell differentiation
    111182213 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182213 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111182213 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111182213 (IL4R)
   04090 CD molecules [BR:dle04090]
    111182213 (IL4R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111182213 (IL4R)
CD molecules [BR:dle04090]
 Proteins
  111182213 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 111182213
NCBI-ProteinID: XP_022444166
UniProt: A0A2Y9PE46
LinkDB
Position
Unknown
AA seq 831 aa
MGWLRSGLTFSVGCLILVWAAGCGSSCSEVSCVSPGSVRVLQGPTCFSDYVNISTCEWEM
AWPTNCRAELRLFYQLKFFYFENHTCVPENRAGAVCVCHMHMDNVVSVDTYQLDLWAGEQ
LLWKSSFKPSEHVKPLAPRNLTVHANISRTWLLTWNNPYPPENHLYSELTYLVNISNEND
PTDFRIYNVTYKGPTLRFAASTLKSGASYSAQVKAWAQSYNSTWSEWSPSAKWLNYYEAT
LEQRLPLGVSISCVVILAVCLSCYVSIIKIKKEWWDQIPNPAHSPLVAVVIQDSQVSLWG
KRSQGQEPAKCPHWKTCLAKLLPCLLEHGMERDEDSAKAARNEPFQCPGKVAWHPMEVNK
TILWPESISFVRCVELFEAQVENEEEEVEEDKGSFCPSPDSSGGSFQEGREGIAARLAES
LFLDLLGGEDRGFSPQGLEESCLLPPLENPSVQRPWATSPGVGPQEASSEDKEPLNPESS
PPTQSPARLAFPDMPGVIADNPTYRSFSTFLSQSSGPGELDSDPQLAEHLGEVDPSIPAA
PQQSAPPTALQPEPETWEQILRQSVLQCRAAPGPASAPSSGYREFVQAVKQGGARDSGLE
GFGPCGEAGYKAFSSVLAGTASCPGTSGPEPSSGEGGYKPFQSLTPGCPRAPAPVPVPLF
TFGLDVEPPHSPQDSLLPGSTPECPGLEPVVKGQDSQKPLLSPEPTTDPLGDDLANGIVY
SALTCHLCGHLKQCHGQEERGKAHIEASPCCGCCRGDGSSPPVSPLRALDTQLGGALEAS
LSPASLAPLGVSEEGKSPLFFQTAPNNAQSSSQTSTVVAMLSPGPTCTDAS
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggggtggcttcgctctgggctcacgttttcggtgggctgtctgatcctggtgtgggcg
gcaggctgtggctccagctgctcagaggtctcctgtgtctccccagggagtgtgagggtc
ctgcaggggcccacctgcttctccgactacgtcaacatctccacctgtgagtgggagatg
gcctggcccaccaactgcagagctgagctccgcctgttctaccagctgaaattcttctac
tttgaaaaccacacgtgtgtccccgagaacagagctggcgcggtgtgcgtgtgccatatg
catatggataacgtggtcagtgtggacacctaccagctggacctgtgggctggggagcag
ctgctgtggaagagctccttcaagcccagtgagcatgtgaaacccctggcgcccagaaac
ctcactgttcacgccaacatctcccgcacgtggctgctgacgtggaacaacccgtaccct
cctgagaatcacctatactccgagctcacctacctggtcaacatctcaaatgagaacgac
cccacggatttcagaatttataacgtgacctacaaggggcccaccctccgctttgcagcc
agcaccctaaagtctggagcttcctacagcgcacaggtgaaggcctgggctcagagctac
aacagcacctggagtgagtggagccccagcgccaagtggcttaactactatgaggcgacc
ttggagcagcgcctcccactgggcgtcagcatctcctgcgtcgtcatcctggctgtctgc
ctgtcctgctatgtcagcatcatcaagattaagaaagaatggtgggaccaaattcccaac
ccagcccacagccccctcgtggctgttgtcattcaggattctcaggtgtcactgtggggg
aagcggtcccaaggccaggaaccagccaagtgcccacactggaagacttgtcttgccaag
cttctgccctgtttactggagcatggcatggaaagggatgaagattccgccaaggctgct
agaaacgagcctttccagtgtcctggaaaagtagcatggcaccccatggaggtcaacaag
acaatcctctggccagagagcatcagctttgttcggtgcgtggagctgtttgaggcccaa
gtggagaatgaagaagaggaagtggaggaagataaagggagcttctgcccatcacctgac
agcagtgggggcagcttccaggagggcagggagggcatcgcagcccggctggcagagagc
ctgttcctggaccttctcgggggcgaggataggggctttagcccacagggcttggaggag
tcctgccttcttccacctttagaaaatccaagtgttcagaggccctgggccacgtcccca
ggtgtggggccccaggaggcatcgtctgaggacaaggagcctttgaacccagagtcaagt
cctccaacccagagcccagccaggctggctttcccagatatgcccggcgtcatcgcagac
aaccccacttaccgcagcttcagcaccttcctgagccagtcctcaggccctggagagctt
gactcagacccacagctggccgaacacctgggggaagtggaccccagcatccccgccgcc
ccccagcaatctgcaccgcccaccgcactccagcctgagccagaaacgtgggagcagatc
ctgcgccagagcgtcctccagtgcagggcagccccgggccccgcctcggcccccagcagt
ggctaccgggagtttgtgcaggccgtgaagcagggcggcgcccgggacagcgggctggag
ggctttggcccttgcggagaggctggctacaaggccttctccagcgtgctcgctggcacc
gctagctgcccggggacatctgggcctgagcccagcagtggggaggggggctacaagccc
ttccagagcctcactcctggctgccccagagcccctgccccagtccccgtccccctgttc
acctttggactggacgtggagccccctcacagccctcaggactcactcctcccaggcagc
accccagagtgccctggtttggagccagtggtcaagggacaagacagccagaagcccctg
ctatccccggagccaaccacagaccccctcggggatgacctggccaatggcattgtctac
tcagccctcacctgccacctgtgtggccacctgaagcaatgccacggccaggaggaacgt
ggcaaggcccacatcgaggccagcccctgctgtggctgctgccgtggggacgggtcctca
cccccggtgagccccctgagggccctggacacccagctcggtggggcattggaggccagc
ctctctccggcctccctagcacccttgggtgtctcagaggagggtaagtcccccctgttc
ttccaaactgcccccaacaatgctcagagctcaagccagacctccacggtggtggccatg
ctctccccagggcccacgtgcacggacgcttcctag

KEGG   Delphinapterus leucas (beluga whale): 111182214
Entry
111182214         CDS       T05885                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor isoform X2
  KO
K05075  interleukin 21 receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182214 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182214 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111182214 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    111182214 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111182214 (IL21R)
   04090 CD molecules [BR:dle04090]
    111182214 (IL21R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111182214 (IL21R)
CD molecules [BR:dle04090]
 Proteins
  111182214 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T
Other DBs
NCBI-GeneID: 111182214
NCBI-ProteinID: XP_022444174
UniProt: A0A2Y9PB48
LinkDB
Position
Unknown
AA seq 540 aa
MLCGWAAPLLLLMLQGAWGCSDLVCYTDYIQTVTCILKTWAPHPGTLTLTWQDSYGELED
EVTSCSLCWSTHNATHAEYTCHMDVLQYMADDVFSVNMTDHSGNHSQECGSFVLAKSIKP
SPPFNVTVTFSGHYDISWSSDYNFFALKGKLQYELRYRKLGDPWALSPGRKLISVDSRSV
SLLPLEFHKGSSYQLQVRAGPQPGSSFQGTWSEWSDPVVFHTQPEEIKGDLYPQLLLILV
IVCLIPVILGLKIHQAWRLWKNVWVQVPSPEPFFQPLYMGHSGDFKKWVGTPFTASSLEL
RSWSPGVPLSLEMHSQCLPQTAAKGLVPIELPEPPDLVEADGVLEPGSWGPAHSTAGSLD
SSAHSQERDRPYGLVSIDTVTVVDAEGLCTWPCTCGDDGYPALNLDTGLEPGPGTEDLLP
GTGATVLSCGCVSASGPAGPGDPLGSLLGRIKLHLKDEEGWAPGPPWDGGSPRGVSDSEA
GSPPAGLDMDTFDSGFVDSDCGSPVEHDFSSPRDEGPPRSYLRQWVVMAPPPAGPGPQAS
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgctctgcggctgggctgcccctctgctcctgctgatgctccagggggcctggggctgc
tcagacctcgtctgctacaccgattacatccagacggtcacctgcatcctgaagacatgg
gccccgcaccctggcacgctcaccctcacctggcaagactcatatggagaactggaggac
gaggtcacctcctgcagcctctgctggtccacccacaatgccacgcatgcagagtacacg
tgccacatggatgtgctccaatacatggccgacgacgttttcagtgtcaacatgacagac
cattcgggcaaccactcccaggagtgcggcagctttgtcctggctaaaagcatcaagcca
tctccccctttcaatgtgacggtgaccttctccggacattatgacatctcctggagctcc
gattacaatttcttcgcgctgaagggcaaacttcagtatgagctgcggtacaggaagctc
ggagacccctgggctctgagtccagggagaaagctgatctcagtggattcgagaagcgtc
tctctcctgcccttggagttccacaaaggctcaagctaccagctgcaggtgcgggcaggg
ccccagcctggttcctccttccaggggacctggagcgagtggagtgacccagtcgtcttc
cacacccagccagaagagataaagggagacttgtaccctcaactgcttctcatcttggtc
atcgtatgcctcatccctgtcatcttaggcctgaagatccaccaggcttggaggctatgg
aaaaatgtgtgggtgcaggtgcccagcccagagcccttcttccagcccctgtacatgggc
cacagtggagacttcaagaaatgggtgggcacccccttcactgcttccagcctggaactg
agatcctggagtccaggggtgcccttgtccctggagatgcacagccagtgcctaccgcag
actgcagccaaggggctggtgcccatagagctgccagagcccccagacctggtggaagcc
gacggggtgcttgagccgggctcctggggcccagcccactccactgctggcagcttggac
agctcagctcacagccaggagagggaccggccgtacggcctggtatccatcgacacggtg
accgtggtggacgcagaggggctgtgcacctggccttgcacctgcggggatgacggctac
ccagccctgaacctggacaccggcctggagcctggcccgggcacggaggacttgcttccg
ggcacgggggccacagtcctatcctgtggctgcgtctcagccagtggccctgccgggccg
ggggaccccctgggcagcctccttggcaggataaagctgcacctcaaggatgaggagggt
tgggcccccgggccgccctgggatggcgggtcgccccgaggggtgtcggacagcgaggca
ggttcacccccagctggcctggacatggacacgtttgacagcggctttgtggactctgac
tgcggcagccccgtggagcatgacttcagtagccccagggacgaagggccccccaggagc
tacctccgccagtgggtggtcatggcccctccacctgcagggcctgggccccaggccagc
tag

KEGG   Delphinapterus leucas (beluga whale): 111183086
Entry
111183086         CDS       T05885                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111183086 (PDGFRB)
   04014 Ras signaling pathway
    111183086 (PDGFRB)
   04015 Rap1 signaling pathway
    111183086 (PDGFRB)
   04630 JAK-STAT signaling pathway
    111183086 (PDGFRB)
   04020 Calcium signaling pathway
    111183086 (PDGFRB)
   04072 Phospholipase D signaling pathway
    111183086 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    111183086 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111183086 (PDGFRB)
   04540 Gap junction
    111183086 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111183086 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183086 (PDGFRB)
   05206 MicroRNAs in cancer
    111183086 (PDGFRB)
   05230 Central carbon metabolism in cancer
    111183086 (PDGFRB)
   05231 Choline metabolism in cancer
    111183086 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    111183086 (PDGFRB)
   05218 Melanoma
    111183086 (PDGFRB)
   05215 Prostate cancer
    111183086 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111183086 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111183086 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111183086 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111183086 (PDGFRB)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111183086 (PDGFRB)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111183086 (PDGFRB)
CD molecules [BR:dle04090]
 Proteins
  111183086 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 111183086
NCBI-ProteinID: XP_022445809
UniProt: A0A2Y9PKM4
LinkDB
Position
Unknown
AA seq 1103 aa
MRPPSAMRAPVLEGQVLLLPLLLLLGPPASWGLVITPPGPELVLNLSSTFVLTCSGPAPV
VWERMSQKPPQEMTTSQDGTFSSVLTLTNVTGLDTGEYFCTYKGSHGLEASERKRLYIFV
PDPTVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVTLHEKKVDVPLPIAYDYQRGFS
GTFEDKTYVCKTTIGDREVDSDAYYVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFEMPHIRSILHIPSAELGDSGTYICNVSESVSDHR
DEKAINVTVVESGYVRLLGELDPVQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTLGDSG
AGEVALSTRNVSETRYVSELTLVRVKVAEAGRYTMRAFHEDAEAQLSFQLQVNVPVRVLE
LSESHPASGEQTVRCRGRGMPQPHLSWSTCSDLKRCPLELPPTPLGNSSEEESLLETNVT
YWAEEQEFEVVSTLRLRRVDQPLSVRCTLHNLLGQDVQEVTVVPHSLPFKVVVISAILAL
VVLTIISLVVLIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLGHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIFIITEYCRYGDLVDYLHRNKHTFLQRCSNKRRPPSAELYSNALP
VGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPS
APERTCRVTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFNGLRSPLDTSSVLYTAVQPNEGDNDY
IIPLPDPKPEVAVEGPLEGSPSLASSALNEVNTSSTISCDSPLEPQEEPEPEPQPESQVE
PEPKRPPDSSCPGPRAEAEDSFL
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgcggcctccgagtgccatgcgagctcctgtcctcgaaggccaggtgctgttgctgccc
ttgctgttgttgctgggaccaccggcctcctggggcctggtcatcacacccccggggcca
gagcttgtcctcaatctctccagcacctttgttctgacctgctcgggtccagctccagtg
gtgtgggaacggatgtcccagaagcccccacaggaaatgaccacgagccaggacggcacc
ttctccagtgtgctgacactgaccaatgtcactgggctagacacaggagaatacttttgt
acctacaaaggctcccatgggctggaggccagcgagcgaaaacgactctacatctttgtg
ccagatcccactgtgggcttcctccctgttgaccccgaggaactattcatctttctcacg
gaaataaccgagaccacaattccatgccgagtgacggatccgagactggtggtgacgttg
catgagaagaaggtggatgtcccgctgcccatcgcctatgactaccaacgtggcttctct
ggtacctttgaggacaagacctacgtctgcaaaaccaccatcggggacagggaggtggat
tcggatgcctactatgtctacagcctccaggtgtcatccatcaacgtctcagtgaatgcg
gtgcagactgtggtccgccaaggggagaacatcaccatcatgtgcattgtgactgggaat
gaggtggtcaactttgagtggacatacccacgcatggagagtgggcggctggtggagcca
gtgaccgacttcctctttgaaatgccccacatacgttctatcctgcacatccccagtgcc
gagctgggagactcagggacctacatctgcaatgtatcagaaagtgtgagcgaccatcga
gatgaaaaggccatcaatgtcaccgtggtcgagagcggttacgtgcggctgctgggagag
ctggaccctgtacaattcgcggagcttcaccgcagccggaccctgcaggtggtgttcgag
gcctacccgccgcccactgtcatgtggttcaaggacaaccggaccctgggtgactccggc
gccggcgaggttgcgctgtccacgcgcaatgtgtctgagacccggtacgtgtcagaactg
acactggtgcgggtgaaggtggctgaagctggccgctacaccatgcgggccttccatgag
gatgctgaagcccagctctccttccagctgcaggtcaacgtgcctgtccgtgtgctggag
ctgagcgagagccaccctgccagcggggagcagacagtccgctgtcgtggccggggcatg
ccccagccacacctcagctggtctacctgcagcgacctcaaaaggtgtccgctggagctg
cctcccacgccactggggaacagttccgaggaggagagcctgctggagacgaacgtgaca
tactgggcagaggagcaggagttcgaggtggtgagcacactgcgcctgcgccgtgtggat
cagccgctgtccgtgcgctgcacgctgcacaacctcctgggccaagacgttcaggaggtc
accgtggtgccacattccttacccttcaaggtggtggtcatctcggcaatcctggccttg
gtggtgctcacgatcatctccctcgtcgtcctcatcatgctctggcagaagaagccacgc
tatgagatccgatggaaagtgattgaatctgtgagctctgatggccatgaatacatctac
gtggaccctatgcagctgccttacgactccacctgggagctgccgcgggaccagcttgtg
cttggacgcaccctgggctccggggcctttgggcaggtggtggaggccacggctcacggc
ctgggccattcgcaggctaccatgaaagtggccgtcaagatgctgaaatccacagcccgc
agcagcgagaagcaagccctcatgtcggagctgaagatcatgagtcacctcgggccccac
ctgaacgtggtcaacctgctgggggcctgcactaaaggagggcccatcttcatcatcacc
gagtactgccgctacggcgacctggtggactacctgcaccgcaacaagcacacctttcta
cagcgctgctccaacaagcgccgcccgcccagtgctgagctctacagcaacgccctgccc
gttgggctcccgctgcccagccatgtgtccctgcctggggagagcgatggtggctacatg
gacatgagcaaagatgagtcagtggactacgtgcccatgctggacatgaaaggggacgtc
aaatacgcagacatcgagtcctccaactacatggctccttatgataactacgtcccctcc
gctcctgagaggacctgccgggtgactttaatcaacgagtccccagtacttagctacacg
gatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaagaat
tgcgtccaccgagatctggcagccaggaatgtgctcatctgtgagggcaaactggtcaag
atctgcgactttggcctggctcgtgacatcatgcgggattcaaactacatctccaaaggc
agtaccttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctctacacc
accctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccctgggtggc
accccgtacccagagctgcccatgaacgagcagttctacaatgccatcaagcggggctac
cgcatggctcagcctgcccacgcctctgacgagatctatgagatcatgcagaagtgctgg
gaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagagactg
ctgggcgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgac
cacccagctgtccttcggtcccaagcccgcttgcccggcttcaatggcctccgatccccc
ctggacaccagctccgtcctctacactgctgtgcagcccaacgagggtgacaacgactat
atcatccccctgcctgaccccaaacccgaggttgctgttgagggaccactggagggttcc
cccagccttgccagctccgccctgaatgaagtcaacacctcctcaaccatctcctgtgac
agccccctggaaccccaagaggaaccagagccagagccccagcctgagtcccaggtggag
ccagagcccaagcggccgccggattccagctgccctgggcctcgggccgaggcggaggac
agcttcctgtag

KEGG   Delphinapterus leucas (beluga whale): 111184548
Entry
111184548         CDS       T05885                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04072  Phospholipase D signaling pathway
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04520  Adherens junction
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111184548 (EGFR)
   04012 ErbB signaling pathway
    111184548 (EGFR)
   04014 Ras signaling pathway
    111184548 (EGFR)
   04015 Rap1 signaling pathway
    111184548 (EGFR)
   04630 JAK-STAT signaling pathway
    111184548 (EGFR)
   04066 HIF-1 signaling pathway
    111184548 (EGFR)
   04068 FoxO signaling pathway
    111184548 (EGFR)
   04020 Calcium signaling pathway
    111184548 (EGFR)
   04072 Phospholipase D signaling pathway
    111184548 (EGFR)
   04151 PI3K-Akt signaling pathway
    111184548 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111184548 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184548 (EGFR)
   04520 Adherens junction
    111184548 (EGFR)
   04540 Gap junction
    111184548 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111184548 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111184548 (EGFR)
   04915 Estrogen signaling pathway
    111184548 (EGFR)
   04921 Oxytocin signaling pathway
    111184548 (EGFR)
   04926 Relaxin signaling pathway
    111184548 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    111184548 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184548 (EGFR)
   05206 MicroRNAs in cancer
    111184548 (EGFR)
   05205 Proteoglycans in cancer
    111184548 (EGFR)
   05230 Central carbon metabolism in cancer
    111184548 (EGFR)
   05231 Choline metabolism in cancer
    111184548 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111184548 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111184548 (EGFR)
   05212 Pancreatic cancer
    111184548 (EGFR)
   05225 Hepatocellular carcinoma
    111184548 (EGFR)
   05226 Gastric cancer
    111184548 (EGFR)
   05214 Glioma
    111184548 (EGFR)
   05218 Melanoma
    111184548 (EGFR)
   05219 Bladder cancer
    111184548 (EGFR)
   05215 Prostate cancer
    111184548 (EGFR)
   05213 Endometrial cancer
    111184548 (EGFR)
   05224 Breast cancer
    111184548 (EGFR)
   05223 Non-small cell lung cancer
    111184548 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111184548 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111184548 (EGFR)
   05171 Coronavirus disease - COVID-19
    111184548 (EGFR)
   05163 Human cytomegalovirus infection
    111184548 (EGFR)
   05165 Human papillomavirus infection
    111184548 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111184548 (EGFR)
   01522 Endocrine resistance
    111184548 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184548 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111184548 (EGFR)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111184548 (EGFR)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111184548 (EGFR)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111184548 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   111184548 (EGFR)
  Exosomal proteins of bladder cancer cells
   111184548 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 111184548
NCBI-ProteinID: XP_022448878
UniProt: A0A2Y9Q0F2
LinkDB
Position
Unknown
AA seq 1209 aa
MRRSEAGRAVLLALLAAHFQASPALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVEKIPLEKLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPILCNMDTVQWRDIVNTDFLSNMSIEF
QSQLSRCPKCDPVCLNGSCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCHSQCAAGC
TGPRESDCLVCRRFRDGATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVRKCPRNYV
VTDHGSCVRACSSESQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFKGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPANRTGLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRRLCYADTINWKKL
FGTSSQKTKITNNRSEKECKAMGHVCDPLCSSEGCWGPKPKDCMSCRNFSRGKECVEKCN
VLKGEPREFIENSECVQCHPECLPQAMNVTCTGHGPGSCVKCAHNIDGPHCVKTCPAGVT
GENSTLIWKFADASHVCHLCHASCAYGCAGPGSEGCAVSGPRIPSIATGMVGALLLALVL
ALGVGLFLRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETELKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHIKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRTLMDEEDMQDVVDADEYLIPQ
QGFFHSPASSRTPLLSSLSSTSNTPTVACGDRNGQSYPLQEDSFLQRYSSDPTGTLNEDS
IDDAFLPAPEYVNQSIPKRPAGSVQNPVYRNQPLNPAPGRDPHYQNSHSNAVDSPEYLNT
TLPACTNGVLDGPALWAQKGGHQISLDNPDYQQAFFPKEAKSNGIFKGSAAENAEYLRVA
PAGSDLTGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacgctccgaagcgggccgcgccgtgctcctggcgctgctggccgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ttgggcacttttgaagaccactttctgagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacatgcaaagtagttacaacctttctttcctaaag
accatccaggaggttgctggctatgtactcattgccctcaacacagtggagaagattcct
ttggaaaagctgcagatcatcagaggaaatgtgctctatgaaaacacccatgccttagcg
gtcttatccaactacggtgcaaataaaacgggactgagggagttgcccatgagaaactta
caggagatcctgcaaggcgccgtgcgattcagcaacaaccctatcctctgcaacatggac
accgtccagtggagggacatcgtcaacaccgactttctaagcaatatgtcgattgaattt
cagagccagctgagcagatgcccaaagtgtgatccagtctgtcttaatggaagctgctgg
ggtgcagggaaggagaactgccagaaactgaccaaagtcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagcgactgctgccacagccagtgtgccgccggctgc
acggggccacgggagagtgactgcctggtctgccgcaggttccgggacggagccacgtgc
aaggacacatgcccgccactcatgctgtacgaccccaccacctacgagatgaaagtcaac
ccgctggggaagtacagcttcggcgccacctgtgtcaggaagtgcccccgtaactacgtg
gtgacggaccacggctcgtgcgtccgcgcctgcagctctgagagccaggaggtggaggag
gacggcgtccgcaagtgtaaaaagtgcgacggaccttgtggcaaagtttgtaacggaata
ggaattggtgagtttaaagacacactttccataaatgctacaaatattaaacacttcaga
aattgcacctcgatcagtggagaccttcatatcctgccagtagcatttaagggtgattcc
ttcacacgtactccacctctggacccaaaggaactggacattctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcctggcctgcaaacaggactggcctccatgctttt
gagaacctggaaatcatacgtggcaggacgaagcaacatggtcagttttctctggcggtt
gttggcctggatataacgtccttgggattacgctccctcaaggagataagtgatggagat
gtgatcatttcaggaaaccgaaggttgtgctacgcagatacaataaactggaaaaaactc
tttgggacctcaagtcagaaaaccaaaattacaaacaacaggagtgaaaaagagtgcaag
gccatgggccacgtctgtgacccgctgtgctcgtcagagggctgctggggcccaaaaccc
aaagactgcatgtcttgccgaaacttcagccgtggcaaggagtgtgtggagaagtgcaac
gttctaaagggagagcccagggagttcattgaaaactccgagtgcgtgcagtgccatccg
gaatgcctgcctcaggccatgaacgtgacctgcacgggacacggaccaggcagctgtgta
aagtgtgcccacaacatcgacggccctcactgcgtcaagacctgccctgctggagtcaca
ggagaaaacagcaccctgatctggaagtttgcagatgccagtcacgtgtgtcacctgtgc
cacgccagctgcgcctacggctgtgctgggccaggttctgaaggctgtgcagtgagtggg
cccaggattccgtccatcgccaccgggatggtgggcgccctgctgctggccctggtgctg
gccctgggggtcggcctctttctgcgcaggcgtcgcatcgtccgcaagcgcacgctgcgc
cggctgctgcaggagcgcgagcttgtcgagcctctgacgcccagcggagaagctcccaac
caagctctcttgaggatcttaaaggagacggaattaaaaaaggtcaaggtgctgggctcc
ggagcattcggcacggtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtggctatcaaggaattaagagaagccacatctccaaaagccaacaaggaaattctt
gatgaagcctacgtgatggccagtgtggacaatccgcacgtgtgccgcctcctgggcatc
tgcctgacgtccacggtgcagctcatcacgcagctcatgcccttcggctgcctgctggac
tatgtccgcgagcacaaggacaacatcggctcccagcacctgctcaactggtgcgtgcag
atcgcaaagggcatgaactacctggaagaccggcgcctggtgcaccgagacctggcggcc
aggaatgtgctggtgaagacaccgcagcacatcaagatcacggatttcggcctggccaaa
ctgctcggcgccgaggagaaagaataccacgcggaggggggcaaggtgcctatcaagtgg
atggctttggaatcaattttacaccgaatttatacccaccagagtgacgtctggagctac
ggagtcaccgtttgggagttgatgacctttgggtccaagccttacgacgggatccccgcg
agtgagatctcaaccgtcctggagaagggagaacgcctgcctcagccgcccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgattgatgcagacagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccccacggactccaacttctaccgcacc
ctgatggacgaagaggacatgcaagatgttgtggatgcggacgagtacctcatcccccag
cagggcttcttccacagccccgccagctcccggacgcccctcctcagttctctgagctcc
accagcaacacgcccactgtggcttgcggtgatagaaacgggcagagctatcccctccag
gaagatagcttcttgcagcggtacagctcagaccccactggcaccttgaacgaggacagc
atagatgacgccttccttccagcgcccgaatacgtaaaccagtctattcccaaaaggccc
gcgggctctgtccagaaccccgtctatcgcaatcagcctctaaacccggctccaggcaga
gaccctcactaccagaattcccacagcaatgccgtggacagccctgagtatctcaacacc
acccttcccgcctgcaccaacggtgtgctcgacggccctgccctctgggcacagaagggc
ggtcaccaaattagcctggacaaccctgactaccagcaggccttctttcccaaggaagcc
aagtcaaatggcatctttaagggttctgccgctgaaaatgcagaatacctaagggtagca
ccagcgggcagcgaccttaccggggcctga

KEGG   Delphinapterus leucas (beluga whale): 111185080
Entry
111185080         CDS       T05885                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111185080 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111185080 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111185080 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111185080 (IL9R)
   04090 CD molecules [BR:dle04090]
    111185080 (IL9R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111185080 (IL9R)
CD molecules [BR:dle04090]
 Proteins
  111185080 (IL9R)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 111185080
NCBI-ProteinID: XP_022449988
UniProt: A0A2Y9Q3L9
LinkDB
Position
Unknown
AA seq 469 aa
MREVGTWLLTCTCMCAWAGLGVSVPGDGEGPGTFTCHTNNILRIDCHWSAPELGQGAGPW
LLFTSNHAPGSKHRCVFRASVCTVELPPEEVLVPSDNFTITFHRHVSGKEQVSLVDPQYL
PRRHVKLDPPSDLLSNITSDHCVLTWSISPALEPLASLLSYELAFKRQEETWERARHKDH
IVGVTWLKLEATELDPGSTYEARLRVQMATPEDAVAEEERYEGPWSDWSQPARFHSPQRQ
GLLVPALGQRDSTLVSVSIFLLLTSLTYLLFKLSPRMKTALYQDVPSPGPFFQSLYSVHN
GDFQTWIGAHRAGPQPSPDCTGPARGAWETRVREAIALLTYDPVDVGPLAGLEEEGSTGT
GLPADALPAGSVEEGGPLPAYLPQEAWVPAGPTRLAPPQSQGSSSDYCTLGCSRWGCPST
FTGSAQSSEPDAALACGPFCDQQSLDARPGGNCAGIGHSQRQDAGGWAA
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcgagaggtgggcacctggctcctgacctgcacctgcatgtgcgcctgggccggcttg
ggcgtctctgtcccaggggacggagaagggcctgggactttcacgtgccacaccaacaac
atcctcaggattgactgccactggtctgccccagagctgggccagggggccggcccctgg
ctgctcttcaccagcaaccacgctccaggcagcaagcacaggtgcgtcttccgggccagc
gtgtgcacagtggagctgccacccgaggaggtgctcgtgccttctgacaacttcaccatc
accttccaccgtcacgtctctgggaaggagcaggtcagcctggtggatccacagtacctg
ccccggagacatgtgaagctggaccctccctctgacttgctgagcaacatcacttctgac
cactgtgtcctgacctggagcattagtcctgccttggagccgctggcctcactcctcagc
tacgagctggccttcaagaggcaggaggagacctgggagcgggctcggcacaaggatcac
atcgttggggtgacctggctgaaacttgaagccactgaattggaccctggttccacctat
gaggcccggctgcgtgtccagatggccacaccagaggacgcggtggcggaggaggagcgc
tacgagggcccatggagtgactggagccagcccgcccgcttccactccccccagagacaa
ggtctcctggtcccagctttggggcagcgcgacagcaccctggtctctgtgtccatcttt
ctcctgctgaccagcctgacctacctgctgttcaagctatcacccaggatgaagacagcc
ttgtaccaggacgtgccatcccccggcccgttcttccagtccctgtacagtgtgcacaac
ggggactttcagacctggataggggcccacagagctggtccacagccaagcccggactgc
acaggccccgcacgaggagcctgggagacccgtgtccgggaggccatcgctttgctcacc
tatgacccggtggacgtggggccgttagcgggcctggaggaggaggggagcacgggcacc
ggcctcccagcagatgcgctgcccgcaggaagtgtggaggagggggggccgctgcccgcc
tacctgccacaggaggcctgggtccccgcaggccctaccaggctggctcccccgcagtcc
cagggcagcagcagcgactactgtaccctgggctgctccaggtggggctgcccctccacc
ttcacaggaagcgcgcagagctctgagcccgacgctgccttggcctgtggccctttctgt
gaccagcagagcctggatgcccggccaggaggtaactgtgcaggcattggtcacagtcag
aggcaggacgctggtggatgggctgcatga

KEGG   Delphinapterus leucas (beluga whale): 111186251
Entry
111186251         CDS       T05885                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04210  Apoptosis
dle04630  JAK-STAT signaling pathway
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186251 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186251 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111186251 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186251 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111186251 (CSF2RB)
   04090 CD molecules [BR:dle04090]
    111186251 (CSF2RB)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111186251 (CSF2RB)
CD molecules [BR:dle04090]
 Proteins
  111186251 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind IL4Ra_N fn3 EpoR_lig-bind IL2RB_N1
Other DBs
NCBI-GeneID: 111186251
NCBI-ProteinID: XP_022452329
UniProt: A0A2Y9PZU4
LinkDB
Position
Unknown
AA seq 902 aa
MALPRGLLPLALLLLCWGPCVAGAQGTFPLQTLRCYNDYTSRIVCRWADTQDSQRLVNVT
LHRRLNRGLPQPVSCDLNDGMPWFDGHCPGCVPRICVIPYEVFVIADHDYFSFRPDQPLG
ARLTVTLSQHVQPPAPRDLNISAAGDSFLLSWNVAHGGSQSHWLSSLEFEVVYRRLQDSW
EDAPTIYSSASRAILGPQHLMPSSTYVARVRTRLAPGSGLSGRPSQWSTEVRWASPPGNE
SQPQNLQCFFDGAALLRCSWEVRSEVTSSVFFTLFYKSGPSAREEECSPVQTEKTSSPYV
RQCCQIPVPDPRNHSQYIVSVRPKAEEKLIKSSDNIQMASPTLNLTKGRDGYILHWKEEK
MNYEHIACIFQVQYKKEAASWEETKTEDFQNAHSMCLPPLEPATRYQARVRVKPDPRGYN
GIWSEWSEESSWDTEWVLPMWVLALTLVISTLILLVSLRFCGIYGYRLNQKWEEKIPNPS
KSHLFQNGRAGLRLPQGTRVVGSGSHAHRGLWGGSFAQPEGASPVDIGHSEVSPLTTEDP
KDACDSSSEPDMTLVTSDLRTEQPPRPPPELATPASRPESQASGFDFNGPYLGPLDSRSL
PDIVGQQGPLRTGMSRKPQPPGSLEYLCLPTGGQVQLVPLAQVMGLGKARDADLRPSPGT
EGSPSLEPGAGPASPEPEVMVGGQGPKDRAPPGLPTGSRGPEEGTVATGYVTTAELTFTP
PTRAPSPSQAPPLSLPSDRNPSLCPGLADGPPGSLAPLKPEFEGYVDLPPTAGQFPQSPL
ASPAPPAASSPVLGPGPPRAGVFSVSPTPEGLLVLQQVGDYCFLPGPGSGPLSPQSKPTS
PGPCPEIKDLNQVFQAKKPPSQAIPQVPAIHQVPAIQLFKALKQQDYLSLPPWDVSRPGE
VR
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggcgctgccccgggggctgctccccctggccctgctgctgctctgctgggggccctgc
gtggcaggggcccaagggaccttccccctgcagaccctgcgctgctataacgactacacc
agccgcatcgtctgcaggtgggcggacacccaggactcccagcggctggtcaacgtgacc
ctccaccgcaggctgaacaggggccttccacagccagtgtcctgcgatctcaatgatggc
atgccctggttcgatggccattgtcccggctgtgtgcccagaatatgtgtcattccctac
gaagtttttgtcattgctgaccatgactacttctcattccgaccagaccagcctctgggt
gcccggctcaccgttactctgagtcagcatgtgcagccccccgcacccagggacctcaac
atcagtgctgctggggacagtttcctgctgtcctggaatgtggcccatgggggttcccag
agccactggctgtccagcctggagtttgaggtggtctacaggaggcttcaggactcctgg
gaggacgcccccaccatctactccagcgcctcccgggccatcctggggccacagcacctc
atgcccagcagcacctatgtggcccgagtgcgcaccaggctggccccgggctcggggctc
tcgggacggcccagccagtggagcacagaggttcgctgggcctccccgccagggaatgag
tcccagccccagaacctccagtgcttcttcgacggggctgccctgctgcgctgctcctgg
gaagtgaggtccgaggtgaccagctcggtcttcttcaccctcttttacaagtccggcccc
agtgcaagggaggaagaatgttccccagtgcagacagagaagaccagcagcccttacgtc
cggcaatgctgccagattcccgtgcctgaccccaggaaccacagccagtacattgtctct
gttcgaccgaaagcggaagagaaacttataaagagctcagataacatccagatggcttct
ccaaccctcaacctgaccaagggcagagacggctacatcctgcactggaaagaagaaaaa
atgaactatgaacacatagcttgcatcttccaggtccagtacaagaaagaagcagcctca
tgggaggagaccaagacagaggacttccagaacgcccacagcatgtgcctgccacctctg
gagcctgccaccaggtaccaggccagagtgagagtcaaacctgacccccgaggctacaac
gggatctggagcgagtggagtgaggagagctcctgggacactgagtgggtgctgcccatg
tgggtcctggcgctcaccctggtcatcagcaccttgatcctgctcgtgtccctgcgcttc
tgtggcatctacgggtacaggctgaaccagaagtgggaggagaaaatccccaacccgagc
aagagccacctgttccagaacgggcgcgctgggctccggctcccacagggcacgcgcgtc
gtcggcagcgggagccacgcacacagggggctctggggcggcagcttcgctcagccggag
ggggcgtcccctgtagacatcgggcacagtgaggtgtcacctctcaccacagaagaccct
aaagatgcctgtgactcgtcatctgagcctgacatgactctggtcacctcggacctccgc
acggagcagccacccaggcccccgccagagctggccaccccggcaagcaggcctgagagc
caggcttccggctttgatttcaatggcccctacctggggccacttgacagccgctccctg
ccggacatcgtgggccagcaggggcccctacggacaggcatgagcaggaaaccgcagccc
ccagggtccctggagtacctgtgtctgcccacaggggggcaggtgcagctggtcccactg
gcccaggtgatggggctgggcaaagccagggatgcggacctgaggcccagcccaggcacc
gaggggagcccttccctggagccaggggcaggccctgcctctcctgagcctgaggtgatg
gtgggtggtcaaggcccgaaggacagggcccccccaggtctgcccactggctctcggggt
cctgaggaaggcactgtggccactggttacgtcaccactgcagagctgacattcacccca
cccacaagggccccatctccttcccaggctccccctctgagcctcccttcagaccggaac
cccagcctctgtcctggactggctgatggtccccctggatccctagccccactgaagcca
gagttcgagggctatgtggatctccctccaaccgcaggccagtttccccagtcccctcta
gccagccctgcccctcctgcagccagcagtcctgtcctgggcccagggccgccccgggca
ggtgtattctcagtctccccaacccctgaggggctcctcgtgctgcagcaggtgggtgac
tactgtttcctccctggcccagggtctggccctctctcaccccagagtaagcccacctcc
ccaggaccctgtcctgagatcaaggacctcaaccaggtgttccaggccaagaagccccca
tctcaggccattccccaggtgccggccattcaccaggtgccggccattcagctcttcaaa
gccctgaagcagcaggattacttgtcactgcccccttgggatgtcagcaggcctggggag
gtgcgctga

KEGG   Delphinapterus leucas (beluga whale): 111186349
Entry
111186349         CDS       T05885                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186349 (IL2RB)
   04151 PI3K-Akt signaling pathway
    111186349 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186349 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111186349 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111186349 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111186349 (IL2RB)
   04659 Th17 cell differentiation
    111186349 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186349 (IL2RB)
   05202 Transcriptional misregulation in cancer
    111186349 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186349 (IL2RB)
   05162 Measles
    111186349 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111186349 (IL2RB)
   04090 CD molecules [BR:dle04090]
    111186349 (IL2RB)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111186349 (IL2RB)
CD molecules [BR:dle04090]
 Proteins
  111186349 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 111186349
NCBI-ProteinID: XP_022452565
UniProt: A0A2Y9Q4J8
LinkDB
Position
Unknown
AA seq 595 aa
MSQLGLPSPAPTRGCDGGSCSVLVSVPPCPLAPGHPSGIYIGERYRSGGRTPEGHGHPAA
SHARLILPADHSKLTCFYNSRANISCAWSRDGGLQVTTCHIHAQPDKRQWNESCELLPVK
PGSWACNLILGPPDSQKLTIVDVINLTVMCREGERWRRMMTHNFKPFDNIRLMPPHSLQV
VHIETRRCNITWNVSQFSHYIQSNVEFEARTRSPGHSWEDTPLLTLRQNQQWISLETLAP
DTLYELQVRARPQLGNHEAWSPWSQPLVFRTRPAATRRKTVPLPSMGHIVLGLCCTFGFV
LLVYLLTSFRYNGLWLKKVLKCHIPDPSEFFSQLSSEHGGDFQKWLSSPFPSSSFSPSGP
VPEISPLEVLDRDAKATQLLLLQQQDKGSSSSTETSGHSVTSCFTNQGYFFFHLPDALEI
EACQVYFAYDPFMEEPDEGGPRVPEGALLPPLPPPPGEEDAYCTFPSGDDLLLFSPSLLG
GPGPPNTALGGIGAGEERLPPTPQEGVPGDWAPQPLAPPTPEAPDPVDLQSPPEHALGEA
GEEVPVPSPREGAGFPWASSSGQGQVWAPTSCLTLNTDAYLSLQELQDQDPAHTV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgtcccagctagggctcccttccccagctcccacccgtggctgtgatggcggctcctgc
tctgtcctggtgtctgtgcctccttgtcctctggcccctggccatccctcgggcatctac
atcggtgaacggtacaggagcggcgggcgaaccccagagggccatgggcaccctgcagcc
agccacgcacgcctcatcttaccagcagatcattccaagctcacgtgcttctacaactcg
agagccaatatctcctgtgcctggagccgggatgggggactgcaggtcacgacgtgccac
atccatgcccagccggataaaaggcagtggaacgaatcctgtgagctgctcccagtgaag
ccgggatcctgggcatgtaacctcatcctaggacccccagattctcagaaactgaccata
gttgacgtcatcaacttgaccgtgatgtgccgcgaaggggagagatggaggaggatgatg
acccacaatttcaagccctttgacaacattcgtctgatgcctccccactccctccaagtc
gtccacatagagacccgcagatgcaacataacctggaatgtttcccagttctcccactac
attcaaagcaatgtggagtttgaggcccggacaaggtccccgggccacagctgggaggac
accccgctgctgaccctcaggcagaaccagcaatggatctccctggagacgctggctcca
gacacgctgtatgagcttcaggtgcgggccaggccccagctaggcaaccacgaggcctgg
agcccctggagccagcctctggtcttcaggacgaggcctgcagcaaccaggaggaagacc
gtgccccttccttcgatgggccacatcgtgttgggcctctgctgcacttttggtttcgtc
ctcttggtttacttgctgaccagctttcggtacaacgggctgtggctgaagaaggttctg
aagtgtcacatcccagacccctcggagttcttttcccagctgagctccgagcatggagga
gatttccagaagtggctctcctctcccttcccctcgtcctccttcagccccagcggccca
gtgcccgagatctccccactggaggtgctggacagggacgccaaggccacgcagctgctc
cttctgcagcagcaggacaagggctcgtcatcctcaaccgagaccagcggccactcggtg
accagctgcttcaccaaccagggctacttcttcttccacctcccagacgcgctggagatc
gaggcctgccaggtgtactttgcctatgaccccttcatggaggagcccgatgagggtggg
cccagggtgccagagggggctctcctcccacccctgccacctccgccaggggaggaagac
gcctactgcaccttcccctctggggacgacctgctgctcttctcccccagtctcctcggt
ggcccaggccccccgaacactgccctggggggcattggggctggtgaagagaggctgccc
cccaccccgcaggagggagtccctggagactgggccccccagcccctggcgcctcccacc
ccggaagcccctgacccggtggatttgcagtcacccccggagcatgcgctgggagaagca
ggagaggaggtgcctgtccccagcccgagggagggggccggcttcccctgggccagctct
tctgggcaaggccaggtctgggcccccacctcctgcctgaccctgaacaccgatgcctac
ctgtccctccaagagctccaggatcaggacccggctcacacagtgtag

KEGG   Delphinapterus leucas (beluga whale): 111186578
Entry
111186578         CDS       T05885                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186578 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186578 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111186578 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111186578 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111186578 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186578 (IL6ST)
   05203 Viral carcinogenesis
    111186578 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111186578 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186578 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111186578 (IL6ST)
   04090 CD molecules [BR:dle04090]
    111186578 (IL6ST)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111186578 (IL6ST)
CD molecules [BR:dle04090]
 Proteins
  111186578 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 111186578
NCBI-ProteinID: XP_022453021
UniProt: A0A2Y9Q671
LinkDB
Position
Unknown
AA seq 918 aa
MLTLQTWIVQALFIFLTTESVGELLDPCGHIHPESSVVQLGSNFTAVCVLKEKCMDYFHV
NANYIFWKTNHVIVPFEQYTVINRTASSVTFTDISLLNIQLTCNIRTFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETHLETNYTLKSEWATEKFDDCKAKRDTRT
SCTVDYSPVYFVNIEVWVEAENALGTVTSDHINFDPVDKVKPNPPHNLSVSNSEELSSIL
KLTWINSSIKSFIRLKYNIQYRTRDASTWNQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIEPSHTHGCRSVQLIWKTLPPFEAH
GKILDYEVTLTRWKSRLQNYTVNDTKLTVNLTNDRYIATLTARNLVGKSDASVLTIPAWG
FQATHPITDLKAFPKDNVLWVEWTAPNESVNRYILEWCVLSDKSPCIPDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGLPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHFNSKDQMYPDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINT
EGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDNVDSSDSILPRQQYFKQNCSQHETSPDISHFERSKQVSSVN
EGAFVRLKQQQISDHISQPYGSGQMKMFQEVPAADAFGPGTEGQVERFETVGMEATIDEG
APKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacattgcaaacttggatagtgcaagccttgtttattttcctcaccactgaatct
gtaggagaacttctagatccatgtggtcatatccaccctgaatcttcagttgtacaactt
ggttctaatttcacagcagtttgtgtgctaaaggaaaaatgtatggattattttcatgtg
aatgctaattacattttctggaaaacaaaccatgttattgttccttttgaacaatatact
gtcataaacagaacagcatctagtgtcacatttacagatatatctttattaaatattcaa
ctcacttgcaacattcgtacatttggacaaattgatcagaatgtttatggaatcagaata
atttcaggcctgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacgcacctggaaacaaactacacttta
aaatctgaatgggccacagagaagtttgatgattgtaaagcaaaacgtgacacccgcacc
tcatgtactgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgctcttgggacggttacctcagatcatatcaattttgatcctgtagataaagtg
aagcccaatccaccacataatttatcagtcagcaactcagaggaactgtctagtatttta
aaattgacatggatcaactcaagtattaagagttttataagactgaaatataacattcaa
tataggaccagagatgcctcaacttggaaccagattcctcctgaagatacagcatctacc
cgatcttcattcactgtccaggaccttaaaccttttacagagtatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggattttggagtgactggagtgaagaagcgagtgggatc
acatatgaagatagaccatccaaggcaccaagcttctggtataagatagagccatctcat
actcatggctgtagatctgtacaactcatatggaagacattgcctccttttgaagcccat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacgtttacaaaattac
acagttaacgacacaaaactgacagtaaacctcacaaatgatcgctacatagcaactctg
acagcaagaaatctggttggcaaatcagatgcatctgttttaactatccctgcctggggt
tttcaagctactcaccccataacggatcttaaagcatttcccaaggacaatgtgctttgg
gtagaatggactgctccaaatgaatctgtaaacagatatatacttgagtggtgtgtgtta
tcagataaatcgccctgtatcccagactggcaacaagaagatggtactgtacatcgcacc
tatttaagaggaaacctagcagagagcaaatgttatttgataacagtcactccagtgtat
gctgatggaccaggactccccgagtctataaaggcataccttaaacaagctccaccttcc
aaaggacctactgtccggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacgctgtcc
tctttgactagtgacactttgtatatggtacgaatggcagcatatacagacgaaggtgga
aaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaagct
attgttgtacctgtttgcttagcattcctattgacaacccttttgggagtattattctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacctccaaggcattttaattcaaaagatcaa
atgtatccagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagcctttcccagaagatctaaaatcattggacctattcaagaaggaaaaaattaatact
gaaggacacagcagtggtattggagggtcttcatgcatgtcatcttctaggccaagcatt
tctagcagtgatgaaaatgaatctgcacagaacacgtcgagtactgtccagtattccact
gtggtacatagtggctacagacaccaggtgccatcggtccaagtgttctcaagatccgag
tccacccagcccttgttagattctgaagaacggccagaagatctacagctggtagataat
gtagatagcagtgacagcattttgcccaggcaacagtatttcaaacagaactgcagtcaa
catgaaaccagtccagatatttcgcattttgaaaggtcaaagcaagtttcatcagtcaat
gaaggagcttttgttagacttaaacagcaacagatttcagatcatatttcacagccctat
ggatctgggcagatgaaaatgtttcaggaagttcctgcagcagatgcttttggtccaggc
accgagggacaagtagagagatttgaaacagttgggatggaggctacaattgatgaagga
gcgcctaaaagttacttaccacagactgtaagacgaggtggctacatgcctcagtga

KEGG   Delphinapterus leucas (beluga whale): 111187036
Entry
111187036         CDS       T05885                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor isoform X1
  KO
K05080  growth hormone receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04080  Neuroactive ligand-receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111187036 (GHR)
   04151 PI3K-Akt signaling pathway
    111187036 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111187036 (GHR)
   04060 Cytokine-cytokine receptor interaction
    111187036 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111187036 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111187036 (GHR)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111187036 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 111187036
NCBI-ProteinID: XP_022453968
UniProt: A0A2Y9QES8
LinkDB
Position
Unknown
AA seq 676 aa
MKIRMEFYTDSLLPCREITRRSQLARRLLIRKGPTGMDLWQLLLTLAVAGSSDAFSGSQA
TPAILVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVHHGLQSPGSIQL
FYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGDTVDQKCFSVE
EIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQW
KMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLFVTLPQMRPFACEEDFR
FPWFLFIIFGIFGLTVTLFLFIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNT
ILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNILGAKDDDS
GRTSCYEPDILETDFNANDMCDGTSEVAQPQRLKGEADRLCLDQKNLDNSPSNDATPASQ
QPSVILGEENKPRSLLIAKTESTHQAGHTQQQLSNPNSLANIDFYAQVSDITPAGSVVLS
PGQKNKAGISQCDMHPEVVSPCQANFIMDNAYFCEADAKKCIALAPHVEVESHVEPSFNQ
EDIYITTESLTTTAGRSGTAERVPSSELPVPDYTSIHIVQSPQGLVLNATALPLPDKEFL
SSCGYVSTDQLNKIMP
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgaagatcagaatggagttttacacagactcattattaccgtgtagggaaattacacgc
agaagccagctcgcgagaagactgctaattcggaaaggtcctacaggtatggatctctgg
cagctgctgttgaccttggcagtggcaggctcaagtgatgctttttctgggagtcaagcc
acaccagctatccttgtcagagcatctcagagtctgcagagagttcatccaggcctagag
acaaattcttccgggaagcctaaattcaccaagtgccgttcacctgaactagagactttt
tcatgccactggacagatggggttcatcacggtttacagagcccaggatccatacagctg
ttctatatcagaaggagcactcaagaatggactcaagaatggaaagaatgccccgattat
gtctctgctggagaaaacagctgttactttaattcatcttatacctccatttggatcccc
tactgtatcaagctaactagcaatggtgatactgtggatcaaaagtgtttctctgttgag
gaaatagtgcaaccagatccacccattggcctcaactggactttactgaacatcagctta
acagggattcatgcagatatccaagtgagatgggaaccaccaccaaatgcagatgttcag
aagggatggatagtcctggagtatgaactgcaatacaaagaagtaaatgagacccagtgg
aaaatgatggaccctgtattgtcaacatcagttccagtgtactcattgagactggataaa
gagtatgaagtgcgtgtgagatccagacaacgaaactctgaaaaatatggcgagttcagt
gaggtgctctttgtaacacttcctcagatgagaccatttgcatgtgaagaagatttccgg
tttccatggttcttatttattatctttggaatatttggactaacggtgacattattctta
ttcatattttctaaacaacaaaggattaagatgttgattctacccccagttccagttcca
aagattaaaggaattgatccagatctcctcaaggaaggaaaattagaagaggtgaacaca
atcttagccattcatgacaactataaacacgaattctacaatgatgactcttgggttgaa
tttattgagctagatattgatgaccccgatgaaaagactgaaggatcagacacagacaga
cttctaagcaatgaccatgaaaaatcacttaatatccttggggcaaaggatgacgactct
ggacgtaccagctgttatgaacctgacattctggagactgatttcaatgccaatgacatg
tgtgatggtacctcagaggttgctcagccacaaaggttgaaaggggaagcagatcgcttg
tgccttgaccagaagaatctagataactcaccttcgaatgatgctacccctgctagccag
cagcccagtgttatcctaggagaggaaaacaaaccaagatcacttcttattgccaaaact
gagtcaactcatcaagctggccatacacagcaacagctcagcaatccaaattcattggca
aacatcgacttttatgcccaggtaagtgacattacaccagcagggagtgtggtcctttcc
ccaggccaaaagaataaggctgggatctcccagtgtgacatgcatccagaagtcgtctca
ccctgccaagcaaacttcatcatggacaacgcctacttctgtgaggcagatgctaaaaag
tgcatcgccctggcccctcatgtcgaggttgaatcacatgtagagccaagctttaaccag
gaagacatttacatcaccacggaaagccttaccactactgctgggaggtctgggacagca
gaacgtgttccaagttctgagttgcctgtcccagactatacctccattcatatagtacaa
tctccacagggcctcgtactcaatgcaactgccctgcccttgcctgacaaagagtttctc
tcatcatgtggctacgtgagcacagaccaactgaacaaaatcatgccgtag

KEGG   Delphinapterus leucas (beluga whale): 111187296
Entry
111187296         CDS       T05885                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111187296 (OSMR)
   04151 PI3K-Akt signaling pathway
    111187296 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111187296 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111187296 (OSMR)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111187296 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 111187296
NCBI-ProteinID: XP_022454534
UniProt: A0A2Y9Q622
LinkDB
Position
Unknown
AA seq 977 aa
MALFAVFQTTFLLALLSLRTYESEVLSEPLPLTPESLKVSVNSTCQCLHLQWTVHSLAYH
QELKMVFQIQISRFKTSNVIWVENYSTTVKRNQVLHWSWESELPLECAAHFIRMRSMVDD
ARIPKPGFWSNWSSWEEADAQNMLGHDPLFVFPKDKLVEEGSNVTICYVSRIHQDNISCY
LEGVQIYGEQLDRSVSAFELKNVSFIREKGTNVFCKVDQGGVLGGIVLFVSKVLEEPKDF
SCETQDLKTLTCTWDPGSDTGLTKQPSQSYTLFESFSGKKTLCKHRNWCDWQVAQDSQET
FNFTLLAENYLRKRSVSILFNLTQRVHPMTPYNLLPKNVGATKATMTWKVHSIGNNSTLL
CQLELLAEGKVIQQSNVSIKVNGEYLLSELEPDTEYVARVRCAYTNHFWKWSELISQKFN
TAEAAPSEAPDVWRNLKLVSGHPTVSLFWKPLSKVHANGKILFYNVIVENLDKPSRFEVL
SIPAPASSTELTLDQCSYQIHVTAHNSVGPSPASVIVVSGDPGNEEVEKGRVNGTEDGFS
VSWKPQSGDATGYVVEWCDGPQDLPCVLQWKNLGPNTTSTVIRSGAFRPGVRYNFRIYGI
STRRMAHLLEKKAGYLEELAPSDNPQVVMSKLTSRSFTLSWKDYSTESQPGFIQGYHVYL
KPKAGEQCHPAFEKTVLPEDSVCCKYTIDNPEQKTFVVENLQPESVYEFIVTPYTSVGEG
PLDAFTKVTTLDEYSHTLIHIILPMIFCILIVMIICYLKSQWLKEKCYPDSPNPYKSSVL
SLIKSKENPHLTIMYVNDCVPDAIEVINKPEGSKIQFLGTRKSPTETEFTKPAYLYLLPT
EKNYSGPGPCICFENFTYNQAASDFASCGHFPVTPQAPRHQLGPLTSPENLLKALEQNYM
NSLGEIPAGEANLNYVSQLASPTSGDKDSLPTNPPEPALCSEYKMQTAIPLGLASAPPSE
NSSLSSTTLLGQGEHCR
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggctctctttgcagtttttcagacaacattcctcttggcattgctgtccttgagaact
tacgaaagtgaagtcttatctgaacctttaccattaactcctgaatcgctgaaagtttct
gtcaattctacgtgtcagtgtttgcatttacaatggactgtccacagcctcgcttatcat
caggaattgaaaatggtttttcagatacagatcagtagatttaaaacatccaatgtcatc
tgggtggagaactacagcaccactgtgaagcggaaccaagtcctgcattggagctgggaa
tccgagctccctctggaatgcgcggcacactttataagaatgaggagtatggtggatgac
gccaggattcccaagccagggttctggagcaactggagttcatgggaggaagcagatgca
cagaatatgcttggacatgatccattgtttgttttccctaaagataagctggtggaagaa
ggctccaacgtcaccatttgttacgtttctaggatccatcaagataacatatcctgttat
ttggaaggtgtacagatatatggagaacagcttgatcgaagtgtgtctgcattcgagttg
aagaatgtgtcttttattagggaaaaagggacaaatgtcttctgtaaggtggaccaggga
ggtgttttgggaggcatcgttctctttgtctcaaaagtgcttgaagagcccaaggacttt
tcttgtgaaacccaggacctcaagactttgacctgtacttgggatcccgggagcgacact
ggcttgactaaacagccttcccaaagctatactttatttgaatcattttccggaaaaaag
acactttgtaaacacagaaactggtgtgattggcaagtagctcaagactcacaagaaact
tttaacttcacactcctggctgaaaactacttaagaaaaagaagtgtcagtattcttttt
aacctgacccaacgagttcatccaatgactccctataacttattacctaaaaatgttggt
gccacaaaagccaccatgacctggaaggtacactctattggaaacaattccacacttttg
tgtcagcttgaactccttgctgaaggaaaagtgatacaacaaagcaatgtttccatcaag
gtgaatggtgagtacctcttaagtgaactggagcctgacacagaatatgtggcccgagta
cgctgtgcttataccaaccacttctggaaatggagtgaattgattagtcaaaaattcaac
acagctgaagctgctccctcagaggctcccgatgtctggagaaacttgaagctggtgtcg
ggacatcctactgtgagtttattctggaagccactatcaaaagtgcatgccaacgggaag
atcctgttctataatgtaattgtagaaaatctagacaagccatccaggttcgaggtcctc
tccatccctgctcccgccagcagcacagaactaaccctcgatcagtgttcttaccaaatc
catgtcacagctcacaacagtgtgggtccttctcctgcttccgtaattgttgtttctgga
gaccctggaaacgaagaggttgaaaaaggaagagttaacggcacagaggatggattttct
gtgtcttggaaaccccaatccggagatgccacaggctatgttgtggagtggtgtgatggt
ccccaggacctgccctgtgttctccagtggaaaaacctaggccccaataccacaagcaca
gtcattcgctcgggtgcttttagaccaggggttcgatacaacttcagaatttatggaatt
tctaccagaaggatggctcatttattagagaaaaaagcaggatacttggaggaactggct
ccttcagacaaccctcaagtggtcatgagtaagttgacctcccgctccttcactctgagt
tggaaggattattccactgaatcccaacctggctttatacaaggataccatgtctacctg
aaacccaaggcgggggagcagtgccacccggcatttgaaaagacagttcttccagaggat
tcagtttgttgcaaatacacaattgacaacccggaacaaaagacatttgttgtggaaaat
ctacagccggaatccgtctatgagtttatcgtcactccttacacaagtgttggcgagggt
cccctggatgccttcacaaaggtcacaactctggatgaatactcccatacactgatacac
atcatcctgcccatgattttctgcattttgatcgtcatgataatttgctacttaaaaagt
cagtggctgaaggagaagtgttatcctgatagtccaaacccttacaagagcagtgtcctg
tcattaataaaatccaaggagaatcctcatctaacaataatgtatgtcaacgactgtgtt
ccagatgctattgaagttataaacaagcccgaagggagtaagatacagttcttaggcact
aggaagtcacccacagaaactgaatttactaagcctgcctacctttacctccttccgacg
gagaagaactactctggccctggaccttgcatctgttttgagaacttcacctataatcag
gcagcttctgactttgcttcttgtggacatttcccagtaacccctcaagccccacgacat
cagctgggaccactgacttcacctgaaaatttactaaaggcactggaacaaaactacatg
aattccctgggagaaatcccagccggagaagctaatttgaattatgtgtcccagttggct
tcacccacctctggagacaaggacagcctgccaacaaatccaccagagccagcactctgt
tcagagtataaaatgcaaacggccatacccctgggtcttgcctccgctcccccaagtgag
aacagcagcctctcctccactacccttttaggtcaaggggaacactgccgctaa

KEGG   Delphinapterus leucas (beluga whale): 111187327
Entry
111187327         CDS       T05885                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111187327 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111187327 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111187327 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111187327 (LIFR)
   04090 CD molecules [BR:dle04090]
    111187327 (LIFR)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111187327 (LIFR)
CD molecules [BR:dle04090]
 Proteins
  111187327 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 IL6Ra-bind Pur_ac_phosph_N TMEM154 DUF3827
Other DBs
NCBI-GeneID: 111187327
NCBI-ProteinID: XP_022454589
UniProt: A0A2Y9Q677
LinkDB
Position
Unknown
AA seq 1095 aa
MMDISLCLKRPSRMGDSKRMRMTSNFQWLLLTVLLLYLMNQVNSQKRRTPRDLKCITNNL
QVWDCSWRAPSGAGHGAAYEVCFENGSHSCYRLEKNVKIPALLPGDHEITINPLHDFGSF
ISKFTLNEKNVSFIPDVPEILDLSADFSTSTLHLKWNDKGSVFPHHSDVIWEIKVLRKKN
MEIVKLVTHNTTLNGRDTIHHWSWTSDMPLECATHYVGIRCYIDDPQFSGRKEWSDWSPL
KNISWSPDSQTKVFPQDRVLLVGSDITVCCVTQEEVLSAQIGSTYCPLIHLDGKNVAIKI
RNISASESSGTNVVFSVEDNMFGTVIFAGYPPDIPQKLNCETYDLKEIICTWNPGRPTFL
VGPRNTSYTLFESFSGKYVRFKRVELPTNESYQLFFQMLPNQEIYNFTLNARNPLGQSES
TLLVNITEKVHPHIPTSIKVKDISSTAVTLSWHLPGSFAKIKLLCQIEINKTNSVHELRN
VTMKGIENSSYLAAVDKLNPYTIYTFRIRCCTDPFWKWSKWSNEKQYLTTEAIPSKGPDT
WREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIQLDKS
DYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQAVGMGNGILLTWNYDPNVTCDYVIKW
CNSSRSEPCLMDWKKVPSNSTETVIESDQFRPGVRYNFFVYGCRNQGYQLLRSIIGYVEE
LAPVVAPNFTVEDTSADSILVKWEEIPVEELRGFLRGYLFYFEKGERDTSKMRVLESGRS
DIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGMGPEKSMFVVTKENSVALIIAIL
IPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGNSALKTLEMN
PCTPNNVEVLETRSTVPKIEDTEIISPVAERPEDNTDVQPENHVVVSYCPPVIEEEIVNP
GADEAGGASQVIYIDIQSMYQPQAKPEEEPKNDPAAGTGYKPQMHLLVTSTVEDLATDDL
DKSAGYRPQANVNTWNLVSPDSPRSTDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSNG
GGWSFTNFFQNKPND
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgatggacatttccttatgtttgaaacgaccatcccggatgggggacagtaaaagaatg
aggatgacttcaaatttccagtggctcttattaacagttcttcttctatatctaatgaat
caagtaaacagccagaaaagaaggactcctcgtgatttgaagtgtataactaacaattta
caagtgtgggactgctcttggagagcaccctctggagcaggccatggtgctgcttatgaa
gtttgctttgaaaacgggtcccattcttgttatcgattggagaaaaatgttaaaatccca
gctcttttacctggtgatcatgaaataacaataaaccctttacatgattttggaagtttt
ataagtaaattcacactaaatgaaaaaaacgtttccttcattccagatgttccagagatc
ttggatttgtctgctgatttctcaacttctacattacacctaaagtggaatgacaagggt
tctgtttttccacatcactcagatgtcatctgggaaattaaagttctacgtaaaaagaat
atggaaatcgtaaaattagtgacccacaatacaactctgaatggcagagatacaattcat
cactggagctggacctcagacatgcccttggagtgcgccactcactatgtgggaattaga
tgctacattgatgatcctcagttctctggtcgcaaagagtggagcgactggagcccactg
aagaacatctcttggtctcctgattctcagactaaggtttttcctcaagacagagtgcta
cttgtaggctcagatataacagtatgttgtgtgactcaagaagaagtgttatcagcacag
attggcagtacatattgtccccttatccatcttgatgggaaaaatgttgcaatcaagatc
cgtaatatttctgcttccgaaagtagtggaacaaatgtggttttctccgtagaagataac
atgtttggaacagttatttttgcaggatatccacctgatattcctcaaaaactgaactgt
gagacatatgacttaaaagagattatatgcacttggaatccaggaagaccgacgttcttg
gtgggcccacgcaatacaagttacactttatttgaaagtttttcaggaaaatatgttaga
tttaaaagagttgagttgcccacaaatgaaagctatcagttattctttcaaatgcttcca
aatcaagaaatatacaattttacgttgaatgctcgaaatcctctgggtcaatcagaatca
acacttttagttaacataactgaaaaagttcatccccatattcctacttcaatcaaagtg
aaggatatcagttcaacagctgttacactttcctggcatttaccgggcagctttgcaaag
attaaactgttatgtcaaattgaaattaataaaactaactcagtacatgaattgcggaat
gtcacaatgaaaggaatagaaaattcaagttatcttgctgctgtggataaattaaatcca
tatactatatatacttttcggattcgttgttgtactgaccccttctggaaatggagcaag
tggagcaatgaaaaacaatatttaaccacagaagccattccttcaaagggaccagatact
tggagagagtggagttctgacggaaaaaatttaataatatattggaagcctttacccatt
aatgaagctaatggaaaaatactctcctataatgtatcatgttcgtccgacgaggaaaca
caatccctttctgaaattcctgatcctcaacataaggcagaaatacaacttgataaaagt
gactacatcatcagtgtggtggcaaaaaattctgtgggctcatcgccaccttctaaaata
gctagtatggaaattccaaatgatgatctcaaaatagagcaggctgttggaatgggaaat
gggattctgctcacttggaattatgaccccaacgtgacttgtgactatgtgattaaatgg
tgtaactcatctcggtctgaaccctgcctcatggactggaaaaaagtcccttcaaacagc
actgaaactgtaatagaatctgatcagtttcggccaggtgtaagatataattttttcgtg
tacgggtgcagaaatcaaggatatcaattactacgttctataattggatatgtagaagaa
ttggctccagttgttgcaccaaattttactgttgaggatacgtctgcagattcgatatta
gtgaaatgggaagaaattcctgtggaagagcttagaggctttttaagagggtatttattt
tactttgaaaaaggagagagagacacatctaagatgagggttttggaatcgggtcgttct
gacataaaggttaagaatattaccgacatatcccagaagacactgagaattgctgatctt
caaggtaaaacaagttaccatctggtcttgcgagcctatacagatggaggaatggggcca
gagaagagcatgtttgtggtgacaaaggaaaattctgtggcattgattattgccattctc
atcccagtggcagtggctgtcattgtcggagtggtaacgagtatcctttgctatcggaaa
cgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaattgtaaagct
ttacagtttcaaaagagtgtctgtgagggaaacagcgctcttaaaacattggaaatgaat
ccttgtaccccaaataatgtcgaggttctggaaactcgatcaacagttcctaaaatagaa
gatacagaaataatttctccagtagctgagcgtccagaagataacactgatgtgcaaccg
gaaaaccatgtggttgtatcctattgtccaccggtcattgaggaagagatagtgaaccca
ggagcggatgaagccggaggggcctcacaagtcatttacattgacattcagtccatgtac
cagcctcaggcaaaaccagaggaagaacccaaaaacgaccctgcagcggggacaggctat
aagccacaaatgcacctcctcgttacttctactgtagaagatctggctacagatgattta
gacaaaagtgcaggttacagacctcaggcaaatgtaaatacttggaacttagtatctcca
gactcacctaggtccacagacagcaacagtgaaattgtctcttttggaagtccatgctcc
attaactcccggcaatttttgattcctcctaaagatgaagattctcctaaatctaatgga
ggaggctggtccttcacaaacttttttcagaacaaaccaaacgattaa

KEGG   Delphinapterus leucas (beluga whale): 111187554
Entry
111187554         CDS       T05885                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha isoform X1
  KO
K05072  interleukin 7 receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
dle05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111187554 (IL7R)
   04068 FoxO signaling pathway
    111187554 (IL7R)
   04151 PI3K-Akt signaling pathway
    111187554 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111187554 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111187554 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187554 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    111187554 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111187554 (IL7R)
   04090 CD molecules [BR:dle04090]
    111187554 (IL7R)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL2 receptor family
   111187554 (IL7R)
CD molecules [BR:dle04090]
 Proteins
  111187554 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 111187554
NCBI-ProteinID: XP_022455059
UniProt: A0A2Y9Q7J5
LinkDB
Position
Unknown
AA seq 459 aa
MTPLGIALGMVFYLLQAVSGESGYAENGDFDDAEMDDYSFSCYSQLEVDGSQHLLTCAFD
DPDINSTNMEFEICGALLEVDCLSFNKLQGVYLIKTKKFLLIGDSKICVKLGRKSMTCKK
MNIVKIVKPEAPFDIRVVYRKGANDFEVTFNTSHLQKKYVKELMHEVAYRQEKSENDWMH
MNLSSTKLMLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEWSPSFHFRTPETNGPGEMDP
VLLIIIILSFFSVVLMVVLACVLWEKRIKPIIWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHKVDGIQARDEAEGFLQDPLPPQLEESEKQRLGGGMQGPNWPSEHVGISPKS
FRGESSFRCLAGNISVCDAPGLPFSRSPDCKEGGKNGPLLYQDLLLGPGTTNSTLPPLFP
FQPGTLTLNPAAQGQSILTSLGSSQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacacctctaggtattgctttgggtatggttttctatttacttcaagccgtttctgga
gaaagtggctatgcagagaatggagactttgacgatgcagaaatggatgactactcattc
tcgtgctacagtcagctggaagtggatggatcccagcacttgctgacctgtgcatttgac
gacccggacatcaacagcaccaatatggaatttgaaatatgtggggcccttttggaggta
gattgcctgagttttaataaactgcaaggggtgtatctcatcaagacaaagaaattctta
ctgattggagacagtaaaatatgtgtgaagcttggaagaaaaagcatgacttgcaaaaaa
atgaacatagtcaaaatagttaaacctgaggctccttttgacataagagtcgtctatcgc
aaaggagcaaatgactttgaggtgacatttaatacatcgcacttacaaaagaagtatgtg
aaagaattaatgcatgaggtagcctaccgtcaggaaaaaagtgaaaatgattggatgcac
atgaatttatccagtacaaagctgatgctcctacagagaaagctacaacccaatgcaatg
tatgagattaaagttcggtccatccctaacaccaactattttgaaggcttctggagtgaa
tggagtccaagtttccacttcagaactccagagaccaatggcccaggggagatggatcct
gttttactaattatcatcattctgagtttcttctctgtggttctgatggtcgttctggcc
tgtgtgttgtgggaaaaaagaatcaagcctatcatatggcccagtctccctgatcataag
aagactctggaacaactgtgcaagaaaccaaaaaaaaatttgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcataaggtggatggcattcaagctagagacgaagca
gaaggctttctgcaagatcctcttcctccacagctagaggagtctgagaagcagaggctc
ggagggggtatgcagggccccaactggccctccgagcatgtaggcatcagcccaaaatct
ttcagaggagagtcgtcattcaggtgcctggctgggaacatcagtgtgtgtgatgcccct
gggctccccttctccaggtccccagattgcaaggaaggtggcaagaatgggcctctcctg
taccaagacctgctgcttggccctggaactacaaacagcaccctgccccctctgtttcca
ttccaacccggaaccctgacattgaaccctgctgcccaggggcagtccatcctcacttcc
ttgggatcaagtcaagaagaagcctatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Delphinapterus leucas (beluga whale): 111187584
Entry
111187584         CDS       T05885                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04080  Neuroactive ligand-receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111187584 (PRLR)
   04151 PI3K-Akt signaling pathway
    111187584 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111187584 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    111187584 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111187584 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111187584 (PRLR)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  Prolactin receptor family
   111187584 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind GHBP
Other DBs
NCBI-GeneID: 111187584
NCBI-ProteinID: XP_022455120
UniProt: A0A2Y9QC36
LinkDB
Position
Unknown
AA seq 673 aa
MGLNVTSRGVKTENEDNPLEAATLGSLIPHSVSIEPLIHFLWKEKGANMKENVASTVVFI
LLLFLNTNLLNGQSPPGKPEIFKCRSPEKETFTCWWKPGADGGLPTSYTLTYHKEGETFT
HECPDYKTGGPNSCYFNKKHTSIWTIYIITVNATNQMGSSSSDPRYVDVTYIVEPDPPVN
LTLELKQPEDRKPYLWIKWFPPTLVDVRSGWLTLQYEIRLKPEKAAEWETHFAGQQTQFK
ILSLYPGQKYLVQVHCKPDHGFWSEWSPESSIPIPNDFSMTDATVWIFVAVLSAVICLIM
VWAVALKGYSMVTCILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTSDCEDLLV
EFLEVDDSGDQPLMPAHSKEHPGQGVKPTHSDPDSDSGRGSCDSPSLLSEKCDEPRANPS
KFHTPEGLEKAEKPETNVTQPQGPQGTSVEGKIPSFHVSGSQSSTWPLLQPPGLHYSRSS
YHSVAVVCKLGLGTAGAAPTLLDKTDTRALKPSQTIETGGEGKAAEHGESESFRSKTDQD
AARLLPQDKTPLTSAKPLEYVEIHKVSKDGALALLPKQNENSGRAEKTSTPETSKEYSKV
SRVMDSNILVLVQDRRAQNLAPFEEPAKEAPPSLPQNPAAVDLASFPAAPSNCRLQLGAL
DYLHPTGFMHPFQ
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggggctaaatgtgacctccagaggggtaaagactgagaacgaagacaacccgttagag
gctgcgacccttggttcactcatccctcattcagtaagcattgaacctctgatccatttc
ctgtggaaagagaagggagccaacatgaaggaaaatgtggcatccacagtggttttcatt
ttgctactgtttctcaacaccaaccttctgaatggacagtcacctcctggaaaacctgag
atctttaaatgtcgttctcccgaaaaggaaacattcacctgctggtggaagcctggggca
gacggaggattacctaccagttacacgctgacttaccacaaggaaggagagacattcacc
catgaatgtccggactacaaaactggtggtcccaactcctgctactttaacaagaagcac
acctccatatggacgatatacatcatcacagtaaacgccacgaaccagatgggaagcagt
tcctcggatccacgttacgtggacgtgacttacatagttgaaccagaccctcctgtgaac
ctgactctggaattaaaacagccagaagacagaaaaccatatctgtggataaaatggttt
ccacccaccctggttgatgtaagatctggttggctcacactccagtatgaaattcgatta
aaacctgagaaggcagctgagtgggagactcatttcgctgggcagcagactcagtttaag
attctcagcttatatccagggcagaaataccttgttcaggttcactgcaagccagaccat
ggattctggagtgagtggagcccagagagctccatcccgatacctaatgacttctcaatg
acagatgcaaccgtgtggatctttgtggccgttctttctgctgtcatctgtttgattatg
gtctgggcagtggctttgaagggctacagcatggtgacctgcatcctccctccggttcct
gggccaaaaataaaaggatttgatactcacctgctggagaagggcaagtccgaggaactt
ctgagcgccctgggatgccaagacttccctcccacttccgactgcgaggacttactggtg
gagttcttagaggtggatgacagtggggaccagccgctgatgccagctcactccaaagaa
cacccggggcaaggcgtgaagcccacgcactcggatcccgacagtgactctggccggggc
agctgcgacagcccttcccttttgtctgaaaagtgtgatgaacctcgggccaatccctcc
aagttccacactcctgagggccttgagaaggcagagaaacctgaaacaaacgttacccag
ccccaaggccctcagggcacaagcgtggaaggcaaaatcccctcttttcatgtcagcgga
tcccaatcttcaacgtggcctttgctgcagccccccggcctgcactactccaggtcatct
taccacagcgttgctgttgtgtgtaagctgggcctgggcacggcaggtgctgcacccact
ttgttggacaaaacagacacacgtgctttaaaaccctcgcaaaccattgagactggcggg
gaaggaaaggcagctgagcacggggagtcagaaagcttccgttccaagactgaccaagat
gcggcacggctgctgccgcaggacaagacccccttgacctctgctaaacccttggagtac
gtggagatccacaaagtcagcaaagatggagcgctggcgctgctcccgaaacaaaacgag
aacagcggccgggcggagaagaccagcacccctgaaaccagcaaggagtactcgaaggtg
tcccgggtgatggatagcaacatcctggtgttggtgcaggatcggcgagcgcaaaacctg
gctccgtttgaagaaccagccaaggaggccccgccatccctgccacagaatccagccgcg
gtagacctggcctccttccccgcggccccgagcaactgcagactccagctcggtgcgctg
gattacctgcatcccacaggttttatgcacccctttcagtga

DBGET integrated database retrieval system