KEGG   Delphinapterus leucas (beluga whale): 111163175
Entry
111163175         CDS       T05885                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05214  Glioma
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111163175
   04115 p53 signaling pathway
    111163175
   04218 Cellular senescence
    111163175
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163175
   05206 MicroRNAs in cancer
    111163175
   05203 Viral carcinogenesis
    111163175
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111163175
   05225 Hepatocellular carcinoma
    111163175
   05214 Glioma
    111163175
   05220 Chronic myeloid leukemia
    111163175
   05218 Melanoma
    111163175
   05219 Bladder cancer
    111163175
   05223 Non-small cell lung cancer
    111163175
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111163175
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111163175
   05163 Human cytomegalovirus infection
    111163175
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111163175
   01522 Endocrine resistance
    111163175
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank DUF2384
Other DBs
NCBI-GeneID: 111163175
NCBI-ProteinID: XP_022407374
UniProt: A0A2Y9LCG5
LinkDB
Position
Unknown
AA seq 152 aa
METSADWLATAAARGRADEVRALLEAGAPAHAPNRYGRSPIQVMMMGSARVAELLLLHGA
DPNCADPATLTRPVHDAAREGFLDTLVALHRAGAQLDVRDAWGRLPVDLAEERGHRDVAR
YLRAAAGGTEGGSHARADSAEGPADSPALKNP
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagacctcggctgactggctggctaccgccgccgcccggggccgggctgatgaggtg
cgagcgctgctcgaggcgggggcgccggcccacgcgccgaaccgttacggtcggagcccg
attcaggtcatgatgatgggcagcgcccgcgtggccgagctgctgctgctccacggtgcg
gaccccaactgcgcggaccccgccaccctcacccgacccgtgcacgacgccgcccgggag
ggcttcctggacacgttggtggcgctgcaccgagccggggcgcagctggacgtgcgcgac
gcctggggccgcctgcccgtggacctggctgaggagcggggccaccgcgacgtcgcccgc
tacctgcgcgcggctgcagggggcaccgaaggcgggagccacgcccgcgcagactccgcg
gaaggtcccgcagacagtcccgccctaaagaatccttga

DBGET integrated database retrieval system