KEGG   Delphinapterus leucas (beluga whale): 111163281
Entry
111163281         CDS       T05885                                 

Gene name
HSPG2
Definition
(RefSeq) basement membrane-specific heparan sulfate proteoglycan core protein isoform X1
  KO
K06255  basement membrane-specific heparan sulfate proteoglycan core protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04512  ECM-receptor interaction
dle05161  Hepatitis B
dle05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111163281 (HSPG2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111163281 (HSPG2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111163281 (HSPG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111163281 (HSPG2)
   00535 Proteoglycans [BR:dle00535]
    111163281 (HSPG2)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111163281 (HSPG2)
Proteoglycans [BR:dle00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   111163281 (HSPG2)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF Ig_6 Ldl_recept_a C2-set_2 Laminin_G_3 EGF hEGF
Other DBs
NCBI-GeneID: 111163281
NCBI-ProteinID: XP_022407547
UniProt: A0A2Y9LKG0
LinkDB
Position
Unknown
AA seq 4408 aa
MGRQAAGALLLALVLHGRLLGVTCGLRAYDGLSLPEDAETVPAGRAVWSYSDLSDDEDFL
ADEVSGDGVGSGDLGSGDFQMVYFRALVNFTRSIDYSPQLEDAGSEEFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEVLHTVISSGSIASYITS
PQGFQFRRLGTVPQFPRVCTEAEFACHRYNECVALEYRCDRRPDCRDMSDELDCEEPVPK
LSSQPPPLAETPPVPSQPETAIPRQLPATPAPQVVFPSPGRPVSCGPHEATCRSGHCIPK
DYVCDGQEDCRDGSDELDCGPTPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEADCP
AKHPEDVCGPTQFRCVSTSTCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQESVQASR
GQTVTLTCVAIGVPTPIINWRLNWGHIPSHPRVTMTSEGGRGTLTIRDVKEADQGAYTCE
AMNTRGMVFGIPDGVLELIPQRGPCPDGHFYLEHSTSCLPCFCFGITTVCQSSSRFRDQI
RLRFDRPSDFKGVNVTTPTQPGMPPLSSTQLQIDTALQEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYKVRYELARGMLEPVQRPDVVLVGAGHRLLSRGHTPTQPGSVNLR
QVHFSEEHWVHESGQPVQRAEMLLVLQSLEAVLIQTVYNAKMASVGLSDISMDTTVTYAT
SHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPVQPGGKCRPTNQQIVRCDERGSTGTSGEACLCKLPALC
LQSNVVGRLCNECVAGSFHLSTRNPDGCLKCFCMGVSRQCTSSSWSRAQVLGASEEPTPF
SLTNAAGTHNTSEGISSPMPGELVFSSFHSLPSGPYFWSLPSRFLGDKVTSYGGELRFTV
TQQPQPGSAALHRQPLVVLQGNNIILEHHTSQEPSPGQPSTFTVPFREQAWQRPDGQPAT
REHLLMALAGIDTLLIQASYTQRPAESRVSGISMDVAVPEDTGQDPALEVEQCTCPPGYR
GPSCQDCDTGYTRMPSGLYLGTCERCSCHGHTEVCEPETGSCQGCQHHTEGPRCEQCQPG
YYGDAQHGTPQDCQPCPCRGAPAAGQATHTCFLDTDGHPTCDACSPGHSGRHCERCAPGY
YGNPSQGQPCRRDGQLPEPTGCGCDPQGSISDQCDSAGQCQCKAQVEGLTCSYCRPHHFH
LSASNPVGCLPCFCMGVTQQCTSSSYTRHLISTHFAPGDFQGFTLVNPQRNSHLTGGFTV
EPVPEGAQLTFGNFANLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGAQGSPLSDP
DVQITGNNIMLVASQPALQGPERKSYEIIFREEFWRRPDGQPATREHLLMALADLDELLV
RATFSSMPLAASISAVSLEVAQPGPSEGPRALEVEECRCPPGYVGSSCQDCAPGYTRTGS
GLYLGHCELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDPTAGTPEDCQPC
ACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCATGYVGNPNVRGGQCLPQAD
QAPLVVQVQPTRSIVPQGGPHSLRCHVSGSPPHYFYWSREDGRPLPSSTQQRHQGSELHF
PSVQPSDAGVYICTCRNLHHANTSRAELLVTEAPSKPITVTVEEQRSQSVRPGTDVTFIC
TAKSKSPAYTLVWTRLHNGKLPARAMDFNGILTIRSVQPSDAGTYVCTGSNMFAMDQGTA
TLHVQASATPSSPVVSIHPPQLTVQPGQLAEFRCSATGNPTPTLEWTGGPGGQLPQKAQI
HGGILRLPAVEPSDQAQYLCRAHSSAGQHVARAVLHVHGGSGPRVQVSPERTQVHEGRSI
RLYCRAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITAADAGFYLCVATSPAGT
AQARIQVVVLPASGASIPPVRIESSSPSVTEGQTLDLNCMVTGLAHSQITWYKRGGSLPP
HAQVHGSRLRLPHVSPADSGEYVCRVENESGPKEASIIVSVLHGSHSGPSYTPAPGGAPA
PGSSQPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSLLRLNQ
VSPADSGEYVCRVVLGSGPLETSVLVTIEAAGTGSIPAPGPVLPVRIESSSPTVAEGQTL
DLSCVVPGQAHAPVTWYKRGGSLPARHQVRGSRLYIFQASPADAGEYVCRASNGVEASIT
VTVTRTQGANFAYPPGGTQSIRIEPSSSHVAEGQTLDLNCVVPRQAHTQVTWHKRGGSLP
ARHQTHGSLLRLYQVSPADSGEYVCRVVGGSVPLEASVLVTIESADSVPALGVTPPVRIE
SSSSHVAEGQTLDLNCLVSGQAHAQVTWHKRGSSLPARHQVHGSRLRLPQVTPADSGEYV
CRVVSSSGTQEASVLVTIQQRLGPSRSQSVVYPVRIESSSASLANGHTLDLNCLVASQAP
HTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIQGSGS
SHMPSVSPPIRIESSSPTVVEGQTLDLNCVVTGQPQATITWYKRGGSLPTRHQAHGSRLR
LHQMSVADSGEYVCRANNNIDAQEASIVVSVSPSTGSPSVPGAATPIRIESSSSHVAEGQ
TLDLNCVVPGQAHAQVTWYKRGGSLPTHHQAHGSRLRLHQVSPADSGEYVCRVVSSSGPL
ETSVLVTIEASGSGAVLVPAPGGAPPILIETSSSHVAEGQTLDLKCVVPGQAHAQVTWHR
RGGSLPARHQVHGPLLRLNQVSPADSGEYSCRVASSSGTLEASVLVTIEASSPGPIPAPG
LAQPIYIEASSSHVAEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSRLRLHHVS
QADSGEYVCRVVGGSGPEHEASFTVTVPPSAGSSYRLRSPVISIDPPSSTVRQGQDASFK
CLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGAYRCVASNAYGVAQS
VVNLSVHGPPTVSVLPESPVRVKVGKAITLECVSAGEPRPSARWTRIGAPTNLEQRAPGH
VDSHAVLQISSAKPSDAGVYVCLAQNALGTAQKRVEVIVDTGTVAPGTPQVQVEEAELTV
EAGHTATLRCSATGSPTPTIRWSKLRSPLPWQHQLEGDTLIIPRVAQQDSGQYICNATSP
AGHAEATIALHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGGSLPGRA
TSRNEMLLLEPAAPADSGRYRCRVTNKVGSAEAFAQVLVRGPSGSLPATPIPAGSAPTVQ
VTPQLETKSIGASVEFHCVVPSDLGTQLRWIKEGGQLPPGHSIHDGVLRIQNLDQSCQGT
YVCQAHGPWGQAQASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWS
KVGGRLRPGVVQSGGIVRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISTPPE
VRVPTGSSAVFPCMASGYPTPDITWSKLDGNLPPDSRLENNMLLLPSVQPQDAGTYVCTA
TNRQGKVKAFAHLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIKITFRPDSADGMLLY
NGQKRIPGSPANLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPSPLALGQFHTVTLL
RSLTQGSLIVGSLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVREL
RIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCQDSESSSYVCVCPAGFTGSRCEHS
QALHCHPEACGPDATCVNRPDGQGYTCRCHLGRSGMRCEEGVTVTTPSLSGAGSYLALPA
LTNTHHELRLDLEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLR
SSEPLALGHWHHMSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSLQL
PLATNTSAHFRGCVGEVSVNGKRLDLTYSFLGSRGVGQCYDSSPCERQPCRNGATCMPAG
EYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQGTRCLCPPGFSGPRCQQGSAHGI
AESDWHLEGSGGNDAPGQYGAYFYDDGFLALPGRIFSRSHPEVPETIELEVQTSTASGLL
LWQGVEVGESGRGKDFISLGLQDGHLVFSYQLGSGEARLVSEDPINDGEWHRVMALREGR
RGSIQVDGEELVSGQSPGPNVAVNTKGSIYVGGAPDTAVLTGGRFSSGITGCIKNLVLHS
ARPGTPPPQPLDLQHRAQAGANTRPCPS
NT seq 13227 nt   +upstreamnt  +downstreamnt
atggggcggcaggcggcgggcgcgctgctgctggcgctggtgctgcacgggcggctgctc
ggggtaacctgcgggctgagggcatatgatggcttgtccctgcccgaggatgcagagaca
gtcccggcgggccgtgctgtctggagctattcagacctttctgacgatgaggacttcctg
gctgatgaggtctccggagatggtgtgggcagcggggacctgggcagcggggacttccag
atggtttatttccgagccctggtaaatttcactcgctccatcgactacagccctcagctg
gaggatgcaggctccgaggagttccgagaggtgtccgaggctgtggtagacacgctggag
tcagagtacttgaagattcctggagaccaggttgtcagtgtggtgttcatcaaggagctg
gacggctgggtctttgtggagctggatgtgggctccgaagggaatgcagatggggctcag
attcaggaggtgctccacaccgtcatctccagtggctccatcgcctcctacatcacctct
ccccagggattccagttccgacgcctgggcacagtgccccagttcccaagggtctgcacc
gaggcggagtttgcctgccaccgctacaatgagtgtgtggccctggagtatcgctgtgac
cggaggcctgactgcagggacatgtctgatgaactcgattgtgaggagccggtccccaag
ctcagctcgcagccaccacctctggcggagacaccacctgtaccgtcccagccggagaca
gccatcccacggcagctcccagccacccctgctccccaggttgtattccccagtccaggc
aggcccgtgtcttgtgggccccacgaggccacatgccgcagtgggcactgcatccccaaa
gactacgtgtgtgatgggcaggaggactgcagggacggcagtgacgagctggactgcggc
cccaccccaccctgtgaacccaacgagttcccctgtggaaacgggcactgtgccctcaag
ctgtggcgctgtgatggcgactttgactgtgaggaccgcaccgatgaagccgactgcccc
gccaagcaccccgaggacgtatgcgggcccacgcagttccgctgtgtctccacaagcacg
tgcatcccggccagcttccactgtgacgaggagagtgactgtcccgaccgcagcgacgag
tttggctgcatgcctccccaggtggtgacccctccccaagagtcggtccaggcttcccgg
ggccagacagtgaccctcacctgtgtggccattggcgtccccacccccatcatcaactgg
agactcaactggggccacatcccctctcatcccagggtgacaatgacgagtgagggaggc
cgtggcacgctgaccattcgtgatgtgaaggaggcagaccagggcgcctacacatgtgag
gccatgaacacccgaggcatggtgttcggcatccctgacggtgtcctggagctcatcccc
cagcgaggaccctgccccgacgggcacttctacctggagcacagcacctcctgcctgccc
tgcttctgctttggcatcaccaccgtgtgccagagcagcagccgcttccgagaccagatc
cggctgcgctttgaccggcccagtgacttcaagggcgtgaatgtgacgacgcccacgcag
cctggcatgccgcccctctcctccacccagctgcagatcgacaccgctctgcaggagttc
cagctggtcgacttgtcccgacgcttcctggtccatgactctttctgggctctgcctgag
cagttcctgggcaacaaggtggactcctacggtggctccctgcgctacaaggtgcgctat
gagctggcacgtggcatgctggagccagtgcagcggccagacgtggtcctggtgggcgcc
ggacatcgcctgctctcccgaggccacacacccacccagcccggttctgtgaacctgcgc
caagtccacttctctgaggagcactgggtccatgagtctggccagccagtgcagcgagcg
gagatgctgctggtgctgcagagcctggaagctgtgctcatccagaccgtgtacaacgcc
aagatggccagcgtggggctgagtgacatctccatggatacaactgtcacctacgctacc
agccatggccgcgcccacagcgtagaggagtgcagatgccccattggctattccggcttg
tcctgtgagagctgtgatgcccacttcacccgggtgcctggtgggccctacctgggcacc
tgctctggctgcaactgcaatggccatgccagctcctgtgaccctgtgtatggccactgc
ctgaactgccagcacaacacagaggggccacagtgcaacaaatgcaaggccggcttcttt
ggtgacgccaccaaggccacggccactgcctgccggccctgcccttgcccatacatcgac
gcctcccgcaggttctcagatacctgcttcctggacacggatggccaagccacgtgtgat
gcatgtgccccaggctacacgggccgccgctgtgagagctgtgcccccggatatgagggc
aaccccgtccagcccggcgggaagtgcaggcccaccaaccagcagattgtgcgctgtgat
gagcgaggcagcacggggacctctggagaggcctgcctctgtaagctcccagctctgtgc
ctgcagagcaacgtggtggggcgcctgtgcaacgagtgtgtcgctggatctttccacctg
agcacccgcaaccctgacggctgcctcaagtgcttctgcatgggcgtcagtcgccagtgc
accagctcctcctggagccgcgcacaggtgctgggggcctctgaggagcccactccgttc
agcctgaccaacgccgcgggcacccacaacaccagcgagggcatctcgtcacccatgccc
ggggaactggtcttctcctccttccacagcctcccgtctgggccctacttctggagcctc
ccttcacgcttcctgggggacaaggtgacctcctatggcggggagctgcgctttacggtg
acccagcagccccagcctggctccgcagccctgcacaggcagccgctggtggtactgcag
ggcaataacattatcttggagcatcacacttcccaggagcctagccccggccagcccagc
accttcaccgtgcccttccgagagcaagcatggcagcggcctgacgggcagccggccacg
cgggagcacctgctgatggcactggcgggcatcgacacccttctgatccaggcatcctac
acccagcggccagcggagagcagggtctctggcatcagcatggatgtggctgtgcctgag
gacaccggccaggaccctgcactggaagtggagcagtgtacctgcccacctgggtaccgt
ggcccatcctgccaggactgtgacacaggctatacacgcatgcccagcggcctctacctg
ggcacctgcgaacgttgcagctgccatggccacacagaggtctgtgagcccgaaacaggt
tcctgccagggctgccagcaccacacagaaggcccccgatgtgagcagtgccagcccgga
tattacggggatgcccagcatgggacaccacaagactgccagccatgcccctgtcgtgga
gcccccgctgctggccaagccacccacacttgctttctggacacagatggccaccccacc
tgtgatgcgtgttccccaggccacagcgggcgtcattgtgagaggtgtgccccaggttac
tatggcaaccccagccagggccagccttgtcgaagagacggccagttgccagagccgacc
ggctgtggctgtgacccccagggcagcatcagcgaccagtgtgactctgctggacaatgc
cagtgcaaggcccaggtggaaggcctcacctgcagctattgccggccccaccactttcac
ctgagcgccagcaacccggttggctgcctgccctgcttctgcatgggcgtcacccagcag
tgcaccagctcttcctacacacgccacctgatctccacccactttgcccctggggacttc
caaggcttcaccctggtgaacccacagcggaacagccacctgacaggaggcttcaccgtg
gaaccggtgcccgagggtgcccagcttacttttggcaacttcgctaaccttggccacgag
tccttctactggcagctgccggagacataccagggagacaaggtggcagcctatggtgga
aagctgcggtacaccctctcctacacagcgggggcccagggcagcccgctgtctgaccct
gatgtccagatcacgggcaacaacatcatgctggtggcctcccagccagcactgcagggc
ccggagaggaagagctacgagatcattttccgagaggaattctggcgccggcctgatggg
cagccagccacccgtgagcacctcctgatggcactggctgacctggacgagctcctggtc
cgggccacgttctcctcgatgcctctagcagccagcatcagcgcggtcagcctggaggtc
gcccagcccgggccctcggagggaccccgggcccttgaggtggaggaatgccgctgcccc
ccgggctatgtcggctcgtcctgccaggactgtgccccgggctacacgcgcactgggagt
ggactctaccttggccactgtgagctctgcgaatgcaatggccactcagacctgtgccac
ccagagaccggagcctgctcgcaatgccagcacaacgccgctggggagttctgcgagctg
tgtgcacctggctactatggagaccccacggctggaacacctgaggactgccagccctgt
gcctgcccactgaccaacccagagaacatgttctcccgcacctgtgaaagcctgggagct
ggtggataccgctgcacagcctgcgaacctggctacactggccagtactgtgagcagtgt
gccacaggatacgtgggtaaccccaatgtgcgagggggtcagtgcctgccacaggcagac
caagccccgctggtggtccaggtccagccaactcggagcatagtaccccaaggtggtccc
cactccctgcggtgccacgtcagtgggagcccaccccactacttttactggtctcgtgaa
gatgggcggcccttgcccagcagcacccagcagcgacatcaaggctccgagctccacttc
cccagcgtccagccttcagatgctggagtctacatttgtacctgtcgtaatctccatcat
gccaacaccagccgggcagagctgctggtcactgaggctcccagcaagcccatcacagtg
acagtggaagagcagcggagccagagcgtgcgtcccggaaccgacgtcaccttcatctgc
acagccaagagcaagtctccggcttacaccctggtgtggactcgcctgcataacgggaag
ctgccagcccgagccatggatttcaacggcatcctgaccattcgcagcgtccagccgagt
gacgcgggcacctacgtgtgcaccggctccaacatgttcgccatggaccagggcacagcc
acgctgcacgtgcaagcctcggccaccccatcttcccccgtggtctccatccacccgcca
cagctcacagtgcagcctgggcagctggctgagttccgctgcagtgccacagggaacccc
acacccaccctcgagtggacagggggccccggtggccagctccctcagaaggcccaaatc
catggcggcatcctgcgcctgccagccgtcgagccctcggatcaagcccagtacctgtgt
cgcgcccacagcagcgccgggcagcacgtggccagggccgtgctccacgtgcacgggggc
agcgggcctagggtccaggtgagtccagagaggacccaggtacatgaaggccgcagcatc
aggctgtactgcagggctgcgggtgtgcccagcgccaccatcacctggaggaaggagggg
ggcagcctccccccacaggcccggtctgagcgcacagacatcgccacactgctcatccca
gccatcactgccgccgacgccggcttctacctctgcgtggccaccagccccgcgggcacc
gcacaggcccggatccaagtggtcgtccttccagcctcaggtgccagcatcccgccagtg
aggattgagtcctcatcaccttccgtgactgaagggcagacactggacctcaactgcatg
gtgacagggctggcccacagccagatcacatggtacaagcgagggggcagcctgcctccc
cacgcccaggtacatggctcccggctgcggctgccccacgtctcaccagctgattctgga
gaatacgtgtgccgagtggagaatgagtcagggcccaaggaggcctccatcatcgtctct
gtcctccacggcagccattcgggccctagctacaccccagctcctggtggagccccagct
ccaggcagtagtcagcccatccgcatcgagtcgtcctcctctcatgtggccgaagggcag
acgctggatctgaactgtgtggtgcccgggcaggcccacgcccaggtcacgtggtacaaa
cgtggaggcagcctccccgcccggcaccagacccacggctcactgctgcggctgaaccag
gtgtccccagcagactcaggcgagtacgtgtgccgcgtagtcctcggctctgggcccctc
gagacctccgtcctagtcaccatcgaggccgccggcactggctccatccccgccccagga
cccgtcctgcctgtcaggatcgaatcctcatcccccacggtggccgaggggcagaccctg
gatctgagctgtgtggtgcccgggcaggcccatgccccggtcacgtggtacaaacgtgga
ggcagcctccccgcccggcaccaggtccgcggctcccgcctgtacatcttccaggcctca
ccagctgacgcaggcgagtatgtttgccgggccagcaatggtgtggaggcctccatcaca
gtcacggtaaccaggacccagggagccaacttcgcctaccctcctggtggcacccagtcc
atccgcattgaaccctcctcctctcatgtggccgaagggcagaccctggatctgaactgt
gtggtgcccaggcaggcccacacccaggtcacatggcacaagcgtgggggcagccttccc
gcccggcaccagacccatggctcactgctgagactctaccaggtgtccccagccgactca
ggcgagtatgtgtgccgcgtggtaggtggctcagtgcccctggaagcctctgtcctggtc
accattgagtctgcagactctgtgcctgcgctgggggtcacccctccagtccggatcgag
tcgtcctcctcacacgtggctgaagggcagaccttggatctgaactgcctggtttctggg
caggcccacgcccaggtcacatggcacaagcgcgggagcagcctccctgcccggcaccag
gtacatggctcgaggctgcggctgccccaggtgactccagctgactccggggagtacgtg
tgccgcgtggtcagcagctcgggcacccaggaagcctccgtcctcgtcaccatccagcag
cgcctcggcccctcccgctcccagagtgtggtgtaccccgtccgcattgagtcgtcctca
gcctccctggccaacggacatacgctggacctcaactgcctggtggccagtcaagccccc
cacaccatcacctggtataagcgtggaggcagcctacccagccggcaccagatcgtgggc
tcccggctgcggatcccccaggtgacgcccgcggactcgggcgagtacgtgtgtcatgtc
agcaacggtgccggctcccaggagacctcactcatcgtcaccatccagggcagcggctcc
tcccacatgcccagtgtctccccaccaatcaggatcgagtcctcgtcccccacggtggtt
gaagggcagaccttggatctgaactgcgtggtcaccgggcagccccaggccaccatcacg
tggtacaagcgtgggggcagccttcccactcgacaccaggctcacggctcccgtctgcgg
ctgcaccagatgtccgtggcggattcaggcgagtatgtgtgccgggctaacaacaacatc
gatgcccaggaggcctccatcgtggtctcagtctcccccagcaccggcagcccctctgtc
cctggtgcggccacacccatcagaatcgagtcgtcatcttcacacgtggccgaagggcag
accctggatctgaactgcgtggtccctggacaggcccatgcccaggtcacgtggtacaag
cgcgggggcagcctccccactcaccaccaggcccacggctcacggctacggctgcaccag
gtatccccggctgactcgggggagtacgtgtgccgcgtggtgagcagctctggccctctg
gagacctcagtcctggttaccatcgaggcttctggctctggcgctgttctcgtccctgcc
ccgggcggagccccacccatcctcatcgagacgtcctcctcccacgtggccgaagggcag
accctggatctgaaatgcgtggtgcctggccaggcccacgcccaggtcacatggcacagg
cgcgggggcagccttcccgcccggcaccaggtccacggccccctgctgaggctgaaccag
gtgtcccctgccgactctggcgagtactcctgtcgagtggccagcagctcaggcactctg
gaggcttctgtcctggtcaccatcgaggcctccagcccaggccccattcctgccccagga
ctggcccagcccatctacatcgaggcctcctcctcccatgtggccgaaggacaaaccctg
gacctgaactgtgtggtacccgggcaggcacatgcccaggtcacgtggtataagcgtggg
ggcagcctccccgcccggcaccagacccacggctcccggctgcggctccaccacgtctcc
caggccgactccggagaatacgtgtgccgtgtggttggcggctcgggccctgagcacgag
gcctccttcacggtcaccgtcccgcccagtgcagggtcttcctaccgccttaggagccct
gtcatctctatcgacccgcccagcagcaccgtgcggcagggccaagatgccagcttcaag
tgcctcatccatgatggggcagcccccatcagccttgagtggaagactcggaaccaggag
ctggaggacaatgtccacatcagccccaacggctccatcatcaccatcgtgggcacccgg
cccagcaaccacggtgcctaccgctgcgtggcctccaatgcctatggtgtggcccagagt
gtcgtgaacctcagcgtgcacgggccccctacagtgtctgtgctccccgagagccccgtg
cgggtgaaagtgggaaaggccatcaccctggagtgtgtcagtgctggggagccccgccct
tctgctcgctggacccggatcggtgcccccaccaacttggagcagcgggcacctgggcac
gtggacagccacgcggtgctgcagatttcgtcagctaaaccatcagatgcaggcgtctac
gtctgcctagctcagaatgcactgggcacagcgcagaagcgagtggaagtgattgtagac
acgggcactgtggccccagggactccccaggtccaggtagaagaagccgagctgactgtg
gaagctggacacacggccaccctgcgctgctcagccacaggcagccccacgcccaccatc
cgctggtccaagctgcgctccccgctgccgtggcagcaccagctggaaggtgacacgcta
atcatcccacgggtagcccagcaggactcgggccagtacatctgcaacgccactagccct
gccgggcatgcggaggccaccatcgccctgcacgtagagagcccgccgtatgccaccaca
gtcccggagcacgcctcggtgcaggcaggggagacggtgcagctccagtgcctggctcat
gggacgcccccactcaccttccagtggagccgtgtgggcggcagcctccctgggagggcg
acctccaggaatgagatgctgctccttgagcctgcggcccctgcggactcaggccgctac
cgctgccgggtcaccaacaaggtgggctcagctgaggccttcgcccaggtgctggtccga
ggcccctccggctctctccccgccacccccatcccagcaggatccgcgcccaccgttcag
gtcacgcctcagctggagaccaagagcataggggccagcgtcgagttccactgtgtcgtg
cccagcgacctgggcactcaactccgctggatcaaagaagggggtcagctgcctcccggc
cacagcatacatgatggggtgctccgaatccagaacttggaccagagctgccaagggacg
tatgtttgccaggcccatggaccatggggacaggcccaggccagtgcccagcttgttgtc
caagctctgccctctgtgctcatcaacatccggacctccgtgcagaccgtggtggtcggc
catgccgtggagttcgagtgcctggccctgggtgaccccaagcctcaggtgacgtggagc
aaagttggagggcgcctgcggcctggcgtcgtgcagagcggaggcatcgtcaggatcgcc
cacgtggagctggctgacgcaggacagtaccgctgcaccgccaccaacgccgcaggcacc
acccagtcccacgtgctgctactcgtgcaagccttgccgcagatctcaacgcccccagag
gtccgtgtgcccactggttcttcagctgtcttcccctgcatggcctctggctaccccact
cctgacatcacctggagcaagctggatggaaacctgccgcccgacagccgcctggagaac
aacatgctactgctgccctcggtccagccccaggacgcgggcacctatgtctgcaccgcc
accaaccgccagggcaaggtcaaggcctttgcccatctgcaggtgccagagcgggtggtg
ccctacttcacgcagaccccccactctttcctgccgctgcccaccatcaaggatgcctac
aggaagtttgagatcaagatcaccttccggcccgactcagccgatgggatgctgctgtac
aacgggcagaagcggatcccagggagccccgccaacctggccaacaggcagcccgacttc
atctccttcggccttgtgggcgggaggcccgagttccggtttgatgcaggctcgggcatg
gccaccatccgtcacccctcaccactagcactgggccagttccacaccgtgaccctgctg
cgcagcctcacccagggctccctgatcgtgggcagcctggccccggtcaacggcacctcc
cagggcaagttccagggtctggacctgaatgaggagctctacctgggtggctaccccgac
tatggcgccatccccaaggcagggctgagcagcggcttcataggctgtgtccgggagctg
cgcatccagggtgaggagatcgtcttccacgacctcaaccttacagcgcacggcatctcc
cactgccccacctgtcgggaccggccctgccagaacgggggccagtgccaggactcggag
agcagcagctatgtgtgtgtgtgcccggctggcttcaccgggagccgctgtgagcactcg
caggccctgcactgccacccagaggcctgtgggcccgacgccacctgtgtgaaccggccc
gacggccaaggctacacctgccgctgccacctgggccgctcggggatgaggtgtgaggaa
ggtgtgactgtgaccaccccttccctgtcgggcgcgggctcctacctggcgctgcccgct
ctcaccaacacgcaccacgagctacgcctggaccttgagtttaagccactggcacctgac
ggggtcctgctgttcagcgggggaaagagcgggcctgtggaggatttcgtgtccctggcg
atggttggcggccacctggagttccgctacgagttggggtcagggctggccgttctgcgg
agctccgagcccctggccctgggccactggcatcacatgtccgcagagcgtctcaacaag
gacggcagcctgcgggtgaacggcgggcgccctgtgctgcgctcctcacccggcaagagc
cagggcctcaacctgcacaccctgctctacctgggtggtgtggagccgtccttgcagctg
cccctggccaccaacacgagcgctcacttccgcggctgcgtgggcgaggtgtcagtgaat
ggaaagcggctggacctcacctacagcttcctgggcagccggggcgtcgggcagtgctac
gacagctccccgtgtgagcgccagccttgccgcaatggcgccacgtgcatgcctgccggc
gaatacgagttccagtgcctgtgtcgagacggtttcaaaggagacctctgtgagcacgag
gagaacccctgccagctccgtgagccctgtctgcatgggggtacctgccagggcacccgc
tgcctctgtccccctggcttctctggccctcgctgccaacaaggctctgcacatggcata
gcggagtccgactggcatcttgaaggcagtgggggcaacgatgcccccgggcagtacgga
gcctacttctacgatgacggcttcctcgccctccctggccgcatcttctccaggagtcac
cctgaggtgcccgagaccatcgagctggaggttcagaccagcacggccagcggcctcctg
ctctggcagggcgtggaggtgggagagtccggccgaggcaaggacttcatcagtcttggg
cttcaggatgggcaccttgtcttcagctaccagctgggcagtggggaggcccgccttgtc
tctgaggaccccatcaacgatggcgagtggcatcgggtgatggcactgcgagagggccgg
agaggctccatccaggtggacggagaggagctggtcagcggccagtccccaggccctaac
gtggcagtcaacaccaagggcagcatctacgtcggtggagcccccgacacggcggtgctg
accgggggcaggttctcctcgggcatcacgggctgtatcaagaacctggtgctgcactct
gcccggcctggcaccccgcctccacagccactggacctgcagcaccgcgcccaggcgggg
gccaacacgcgcccctgcccctcgtag

DBGET integrated database retrieval system