KEGG   Delphinapterus leucas (beluga whale): 111163319
Entry
111163319         CDS       T05885                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4 isoform X1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04919  Thyroid hormone signaling pathway
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111163319 (WNT4)
   04390 Hippo signaling pathway
    111163319 (WNT4)
   04150 mTOR signaling pathway
    111163319 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111163319 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111163319 (WNT4)
   04916 Melanogenesis
    111163319 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    111163319 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163319 (WNT4)
   05205 Proteoglycans in cancer
    111163319 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111163319 (WNT4)
   05226 Gastric cancer
    111163319 (WNT4)
   05217 Basal cell carcinoma
    111163319 (WNT4)
   05224 Breast cancer
    111163319 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111163319 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    111163319 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111163319 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111163319 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111163319 (WNT4)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111163319 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 111163319
NCBI-ProteinID: XP_022407610
UniProt: A0A2Y9LDA2
LinkDB
Position
Unknown
AA seq 361 aa
MEALCKTALPPFWPWEPGRMAVTGSREKPTSRIHPWYLAKLSSVGSISEEETCEKLKGLI
QRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAA
FVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFV
DVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQV
GHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLG
TRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggaggccttgtgcaagacagcacttccccccttctggccctgggaaccaggcaggatg
gctgtcactggatccagagagaagccaacctccaggatccatccctggtacctggccaag
ctgtcatcagtggggagcatctcagaggaggagacgtgcgagaagctcaagggcctgatc
cagaggcaggtgcagatgtgcaagcggaacctggaggtgatggactcggtgcgccgcggc
gcccagctcgccattgaggagtgccagtaccagttccggaaccggcgctggaactgctcc
acgctcgactcgctgcctgttttcggcaaggtggtgacgcaagggactcgggaggcggcc
ttcgtgtacgccatctcttcggcaggtgtggcctttgcggtgacacgggcgtgcagcagt
ggggagctggaaaagtgcggctgtgaccggacggtacacggggtcagcccacagggcttc
cagtggtcgggatgctcggacaacatcgcctacggcgtggccttctcacagtcatttgtg
gacgtgcgggagaggagcaagggggcctcgtccagccgggccctcatgaacctccacaac
aacgaggccggcaggaaggctatcctgactcacatgcgggtggagtgcaagtgccacggg
gtgtcgggctcctgcgaggtaaagacgtgctggcgagccgtgccgcccttccgccaggtg
ggccacgcgctgaaggagaagtttgacggcgccacggaggtggagccacgccgtgtgggc
tcctccagggcgctggtgccgcgcaatgcgcagttcaagccgcacacagacgaggacctg
gtgtacttggagcccagcccggacttctgcgagcaggacatgcgcagcggcgtgctgggc
acgaggggccgcacgtgcaacaagacgtccaaggccatcgacggctgcgagctgctgtgc
tgcggccgcggcttccacacggcacaggtagagctggctgagcgctgcagctgcaaattc
cactggtgctgcttcgtcaagtgccggcagtgccagcggctcgtggagctgcacacgtgc
cggtga

KEGG   Delphinapterus leucas (beluga whale): 111168811
Entry
111168811         CDS       T05885                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111168811 (WNT7A)
   04390 Hippo signaling pathway
    111168811 (WNT7A)
   04150 mTOR signaling pathway
    111168811 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111168811 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111168811 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168811 (WNT7A)
   05205 Proteoglycans in cancer
    111168811 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111168811 (WNT7A)
   05226 Gastric cancer
    111168811 (WNT7A)
   05217 Basal cell carcinoma
    111168811 (WNT7A)
   05224 Breast cancer
    111168811 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111168811 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    111168811 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111168811 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111168811 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111168811 (WNT7A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111168811 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 111168811
NCBI-ProteinID: XP_022418254
UniProt: A0A2Y9M7V7
LinkDB
Position
Unknown
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcggtggtagctctgggcgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctcggcgctgggggagcgcaccgtcttcggaaaggagctcaaagtgggg
agccgggaggccgccttcacctacgccatcatcgcagccggcgtggcccacgccatcact
gctgcctgcacccagggcaacctgagcgactgcggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttacacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggagtgt
aagtgccacggcgtgtcgggctcatgcaccaccaagacctgctggaccacgctgccgcag
ttccgcgagctgggctacgtgctcaaggacaagtacaacgaggctgttcacgtggagccc
gtgcgtgccagccgcaacaaacggcccaccttcctgaagatcaagaagccgctctcctac
cgcaagcccatggacaccgacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgacgggcagcgtgggcacgcagggccgtgcctgcaacaagacggccccccag
gccagcggctgcgacctcatgtgctgcggccgcggctacaacacccaccagtacgcccgt
gtgtggcagtgcaactgcaagttccactggtgctgctacgtcaagtgcaacacatgcagc
gagcgcaccgaggtctacacgtgcaagtga

KEGG   Delphinapterus leucas (beluga whale): 111169279
Entry
111169279         CDS       T05885                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111169279 (WNT9A)
   04390 Hippo signaling pathway
    111169279 (WNT9A)
   04150 mTOR signaling pathway
    111169279 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111169279 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111169279 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169279 (WNT9A)
   05205 Proteoglycans in cancer
    111169279 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111169279 (WNT9A)
   05226 Gastric cancer
    111169279 (WNT9A)
   05217 Basal cell carcinoma
    111169279 (WNT9A)
   05224 Breast cancer
    111169279 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111169279 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    111169279 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111169279 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111169279 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111169279 (WNT9A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111169279 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 111169279
NCBI-ProteinID: XP_022419058
UniProt: A0A2Y9MPG8
LinkDB
Position
Unknown
AA seq 365 aa
MLDGPLLARWLAAAFALTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KRLKHKYETALKVGSTTNEATGEAGAISPPRGRATGTGGGDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggcccctgctggcgcgctggctggccgcggccttcgcgctgacgctgctg
ctcgccgcgctgcgcccctcggccgcctacttcgggctgacgggcagtgagcccctgacc
atcctcccgctgaccctggagccggaagcagctgcccaggcacactacaaggcctgcgac
cggctgaagctggagcgcaagcagcggcgcatgtgccgccgggaccccggtgtggctgag
acgctggtggaagcggtcagcatgagtgctctcgagtgccagtaccagttccggtttgag
cgctggaactgtacgttggagggtcgctaccgggccagtctgctcaagcgaggcttcaag
gagacagccttcctttacgccatctcctctgctggcctgacgcatgcactggccaaggcg
tgcagtgcaggccgcatggagcgctgcacttgtgatgaggcccctgacttggagaaccga
gaggcctggcagtggggtggctgcggggacaatctcaagtacagcagcaagttcgtcaag
gagttcctgggtcggcggtctagcaaggatctgcgagcccgtgtggatttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacatgcaagtgccacggcgtg
tcaggctcgtgcaccgtgcggacgtgctggcggcagctggcgcctttccatgaggtgggc
aagcgcctgaagcacaagtacgagacagcgctcaaggtgggcagcaccaccaatgaggcc
accggcgaggccggcgccatctcaccaccgcggggccgggccacagggacgggtggtggc
gacccactgccccgcacaccggagctagtgcacctggacgactcacccagcttctgcttg
gctggccgcttctccccaggcactgccggccgcaggtgccaccgtgagaagaactgcgag
agtatctgctgcgggcgtggtcacaacacacagagtcgggtggtgacccggccttgccag
tgccaggtgcgctggtgctgctatgtggagtgcaggcagtgcacccagcgcgaggaagtc
tacacctgcaagggctga

KEGG   Delphinapterus leucas (beluga whale): 111169289
Entry
111169289         CDS       T05885                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111169289 (WNT3A)
   04390 Hippo signaling pathway
    111169289 (WNT3A)
   04150 mTOR signaling pathway
    111169289 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111169289 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111169289 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169289 (WNT3A)
   05206 MicroRNAs in cancer
    111169289 (WNT3A)
   05205 Proteoglycans in cancer
    111169289 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111169289 (WNT3A)
   05226 Gastric cancer
    111169289 (WNT3A)
   05217 Basal cell carcinoma
    111169289 (WNT3A)
   05224 Breast cancer
    111169289 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111169289 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    111169289 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111169289 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111169289 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111169289 (WNT3A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111169289 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111169289
NCBI-ProteinID: XP_022419075
UniProt: A0A2Y9MBH2
LinkDB
Position
Unknown
AA seq 352 aa
MAPLGYFIFLYGLKQALGNYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECARIYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccgctcggatatttcatattcctctacggcctgaagcaagcgctgggcaactac
ccgatctggtggtccctggctgtcgggccccagtactcatctctggggacgcagcccatc
ctctgcgccagcatcccaggcctggtccccaagcagctgcgtttctgccggaactacgtg
gagatcatgcccagtgtggcagagggcatcaagatcagcatccaggagtgccaacaccag
ttccgtggacgccggtggaattgcaccactgtcaacaacagcctggccatctttggccct
gtgctggacaaagccacccgggagtccgcctttgtgcacgccatcgcttccgccggcgta
gccttcgctgtgacacgctcgtgcgccgagggctccgctgccatctgcggctgcagcagc
cgccaccagggctcgcccggtgagggctggaagtggggcggctgcagtgaggacatcgag
ttcggagggatggtgtctcgggagttcgcagacgcgcgggagaaccgaccagacgctcgc
tccgccatgaaccgccacaacaatgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccatgggctctcgggcagctgtgaggtgaagacctgctggtggtcg
cagcccgacttccgtgccattggtgacttcctcaaggacaagtatgacagcgcctcggag
atggtggtggagaagcaccgcgagtcgcgcggctgggtggagaccctgcggccacgctac
acctacttcaaggtgcccacagagcgcgacctggtctactacgaggcctcgcccaacttc
tgtgagcccaaccccgagacgggatccttcggcacgcgcgaccgcacctgcaacgtgagc
tcgcacggcatagatggctgcgacctgctgtgctgcggtcgcggccataacgcgcgcacc
gagcggcgcagggagaagtgccactgcgttttccactggtgctgctacgtgagctgccag
gagtgcgcgcgcatctacgacgtgcacacctgcaagtag

KEGG   Delphinapterus leucas (beluga whale): 111172090
Entry
111172090         CDS       T05885                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111172090 (WNT6)
   04390 Hippo signaling pathway
    111172090 (WNT6)
   04150 mTOR signaling pathway
    111172090 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111172090 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111172090 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172090 (WNT6)
   05205 Proteoglycans in cancer
    111172090 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111172090 (WNT6)
   05226 Gastric cancer
    111172090 (WNT6)
   05217 Basal cell carcinoma
    111172090 (WNT6)
   05224 Breast cancer
    111172090 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172090 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    111172090 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111172090 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111172090 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111172090 (WNT6)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111172090 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111172090
NCBI-ProteinID: XP_022424018
UniProt: A0A2Y9N433
LinkDB
Position
Unknown
AA seq 365 aa
MQPPAPSRLRLLFLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPPGLPGTPGPPGPAGSPDGSAAWEWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcagccgcctgcgccctcccgcctgaggctgctgttcctgctgctcctgtgtccggcg
cacgtcggcggactgtggtgggccgtgggcagccccctggtcatggaccctaccagcatc
tgcaggaaggcacggcggctagcagggcggcaggctgagttgtgccaggccgagccagaa
gttgtggccgagctagcgcggggcgcccggctaggggttcgagaatgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggcctttgggcgcatcctgcagcag
gacatccgggagacggccttcgtgtttgccataacggccgcgggcgccagccacgccgtc
acgcaggcctgctccatgggcgagctgctgcagtgtggctgccaggcgccccgcggccgg
gccccgccccgtccccccggcctgccaggtacccctgggcccccgggccccgcgggctcc
cccgacggcagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggat
gagaagtcgaggctctttatggacgcgcagcacaagcggggacgcggagacatccgtgcg
ttggtgcaacttcacaacaacgaggcgggccggctggccgtgcggagccacacgcggact
gaatgcaagtgccatggcctgtcgggctcctgcgcgctgcgcacctgctggcagaagttg
cccccgttccgcgaggtgggcgcgcggctgctcgagcgcttccacggcgcctcgcgtgtc
atgggcaccaacgacggcaaggctctgctgcccgctgtccgcacgctcaagccgcctggc
cgcgctgacctactatacgccgccgactcgcccgacttctgcgcccccaaccggcgcacc
ggttcgccgggcacgcgcggccgcgcctgcaacagcagtgccccggacctcagtggctgc
gacctgctgtgctgcggccgcggccaccgccaagagagcgtgcagctcgaggagaactgt
ctgtgccgcttccactggtgctgcgtggtgcagtgccaccgctgccgcgtgcgcaaggaa
ctcagcctctgcctctga

KEGG   Delphinapterus leucas (beluga whale): 111172091
Entry
111172091         CDS       T05885                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111172091 (WNT10A)
   04390 Hippo signaling pathway
    111172091 (WNT10A)
   04150 mTOR signaling pathway
    111172091 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111172091 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111172091 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172091 (WNT10A)
   05205 Proteoglycans in cancer
    111172091 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111172091 (WNT10A)
   05226 Gastric cancer
    111172091 (WNT10A)
   05217 Basal cell carcinoma
    111172091 (WNT10A)
   05224 Breast cancer
    111172091 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172091 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    111172091 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111172091 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111172091 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111172091 (WNT10A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111172091 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 111172091
NCBI-ProteinID: XP_022424019
UniProt: A0A2Y9MNY7
LinkDB
Position
Unknown
AA seq 417 aa
MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAAALPRSSPNDILGLRLPQEPVLNANTV
CLTLPGLSKRQMEVCARHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAISAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLE
ALQRGKGLSHGVPEHPSLPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGPPSPAPDIPGPRRRAGTADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGGMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccctggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctcctcttcttcctactgctgctggctgccgccttgcccaggtcttca
cccaatgatattctgggcctccgcctcccccaggagcccgtgctcaacgctaacacagtg
tgcctgacattgccaggcctaagcaagcggcagatggaggtgtgtgcgcgccaccctgac
gtggccgcctcggccatccagggcatccagatcgccatccatgagtgccagcaccagttc
cgggaccagcgctggaactgctctagtcttgagactcgaaacaagatcccctatgagagt
cccatcttcagcagaggtttccgagagagtgccttcgcctacgccatctcggcagctggc
gtggtgcacgcagtatccaacgcctgtgccctgggcaagctgagggcctgtggctgcgac
gcgtcccggcgcggggacgaggaggccttccgtcggaagttgcaccgcctgcagctggaa
gcgctgcagcgcggtaagggcctgagccacggagttcccgagcacccttccctgcctcct
gccagcccaggcctgcaggactcctgggagtggggcggctgcagccccgacgtgggtttc
ggagagcgcttctctaaagactttctggactcccgggagcctcacagagacatccatgcg
cgcatgaggctccacaacaaccgagtggggaggcaggcggtgatggagaatatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
ccggagttccgcgctgtaggggcactgctacgtagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggccccgcggggccaccctcgcca
gccccggacattccggggcctcggcgccgcgccggcaccgccgacctggtctacttcgag
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaaaagcagcgcgggcccggacggctgcggcggcatgtgctgcggccgcggc
cacaacatcctacgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgc
ttcgtggtctgcgaggagtgccgcatcaccgagtgggtcagcgtgtgcaagtga

KEGG   Delphinapterus leucas (beluga whale): 111172662
Entry
111172662         CDS       T05885                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111172662 (WNT8B)
   04390 Hippo signaling pathway
    111172662 (WNT8B)
   04150 mTOR signaling pathway
    111172662 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111172662 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111172662 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172662 (WNT8B)
   05205 Proteoglycans in cancer
    111172662 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111172662 (WNT8B)
   05226 Gastric cancer
    111172662 (WNT8B)
   05217 Basal cell carcinoma
    111172662 (WNT8B)
   05224 Breast cancer
    111172662 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172662 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    111172662 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111172662 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111172662 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111172662 (WNT8B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111172662 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111172662
NCBI-ProteinID: XP_030615125
LinkDB
Position
Unknown
AA seq 342 aa
MRVTEVARKKRRNWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERA
LQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLW
GGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSC
TTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHL
EDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSC
NCKFHWCCAVRCEQCRRRVTKYFCSRADRPRGGAAHKPGRKP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagagtcaccgaggtagcgagaaagaaaagacggaactggtcagtgaacaatttcctg
atgactggtccaaaggcttacttgatctactccagcagcgtggcagctggtgcccagagt
ggaattgaagaatgcaaataccagtttgcctgggaccgctggaactgccctgagagagcc
ctgcagctgtccagccatggcggccttcgcagtgctaatcgggagacagcatttgtacat
gctatcagttctgctggggttatgtacactctgactagaaactgcagccttggggatttt
gacaactgtggctgtgatgactcccgcaatgggcaactggggggccaaggctggctgtgg
ggaggctgcagcgacaacgtgggcttcggagaggcaatatccaagcagttcgtcgatgcc
ctggagacaggacaggatgctcgggcagccatgaacctgcacaacaacgaggctggccgc
aaggcggtgaagggcaccatgaaacgcacgtgtaagtgccacggcgtgtctggcagctgc
accacgcagacctgctggctgcagctgcctgagttccgagaggtgggcgcgcacctgaaa
gagaagtaccacgcagctctcaaggtggacctgctgcagggtgctggcaacagcgcggcg
ggccgcggcgccatcgcagacacctttcgctccatctccacgagggagctggtgcacctg
gaggactccccagactactgcctggagaacaaaacgctaggactgctgggcaccgaaggc
agagagtgcctgcggcgcggccgggccctgggccgctgggagcgccgaagctgccgtcgg
ctctgcggggactgtgggctagcggtggaggagcgccgcgccgagaccgtgtccagctgc
aactgcaagttccactggtgctgcgcggtccgctgcgagcagtgccgccgccgggtcacc
aagtacttctgcagtcgcgcggaccggccgcgggggggcgcggcgcacaaacccgggaga
aaaccctaa

KEGG   Delphinapterus leucas (beluga whale): 111174054
Entry
111174054         CDS       T05885                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111174054 (WNT10B)
   04390 Hippo signaling pathway
    111174054 (WNT10B)
   04150 mTOR signaling pathway
    111174054 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111174054 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111174054 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174054 (WNT10B)
   05205 Proteoglycans in cancer
    111174054 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111174054 (WNT10B)
   05226 Gastric cancer
    111174054 (WNT10B)
   05217 Basal cell carcinoma
    111174054 (WNT10B)
   05224 Breast cancer
    111174054 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174054 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    111174054 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111174054 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111174054 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111174054 (WNT10B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111174054 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111174054
NCBI-ProteinID: XP_022428027
UniProt: A0A2Y9N9A7
LinkDB
Position
Unknown
AA seq 389 aa
MREEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCSCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRSAPEFRVVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgggaggagccgcggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gctttgtgcagtcgggccctaagcaatgagattctgggtctgaagctgcccggcgagccg
ccgctgaccgccaacaccgtatgcttgacgctgtcgggcctgagcaaacggcagttaggc
ctgtgcctgcgcagccccgacgtgacggcgtccgcgcttcagggcctgcacatcgcggtc
cacgagtgtcagcaccagctgcgtgaccagcgctggaactgctcggcgctcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagagagcgctttttcc
ttctccatgctggctgctggggtcatgcatgcggtagccacggcctgcagcctgggcaag
ctggtgagctgcagctgcggctggaagggcagtggcgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcactgtcccggggcaagagttttccccactccctgcccagcccg
ggccctggctcaggccccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgtcaggtggtaact
gaaaacctgaagcggaaatgcaagtgccatggcacatcaggcagctgccagttcaagacg
tgctggaggtcagccccagagttccgggtggtaggggcggccttgagggagcggctgggc
cgggccatcttcattgatactcacaaccgcaactctggagccttccaaccccgccttcgt
ccccgtcgcctctcaggagaactggtctactttgagaagtctcctgacttctgtgagcga
gaccccaccatgggctccccaggcacgcggggccgggcctgcaacaagaccagccgcctg
ctggatggctgtggcagcctgtgctgtggccgcggccacaacgtgctccggcagacacga
gttgagcgctgtcattgccgtttccactggtgctgctacgtgctatgcgacgagtgcaag
gtcacagaatgggtcaacgtgtgtaagtga

KEGG   Delphinapterus leucas (beluga whale): 111174055
Entry
111174055         CDS       T05885                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111174055 (WNT1)
   04390 Hippo signaling pathway
    111174055 (WNT1)
   04150 mTOR signaling pathway
    111174055 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111174055 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111174055 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174055 (WNT1)
   05205 Proteoglycans in cancer
    111174055 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111174055 (WNT1)
   05226 Gastric cancer
    111174055 (WNT1)
   05217 Basal cell carcinoma
    111174055 (WNT1)
   05224 Breast cancer
    111174055 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174055 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    111174055 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111174055 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111174055 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111174055 (WNT1)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111174055 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111174055
NCBI-ProteinID: XP_022428028
UniProt: A0A2Y9NFI8
LinkDB
Position
Unknown
AA seq 370 aa
MGHWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcctggctgggtttccgctacgctgttgctggcgctggcc
gctctgcctgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctgctgaccgactccaagagcctgcaactggtactcgagcccagt
ctgcagctgctgagccgcaaacagcggcggctcatccgccagaacccggggatcctgcac
agtgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccggaaccgc
cgctggaactgtcccacagcttcggggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaacagcatttatcttcgccatcacctcggccggggtcacccattcggtggcg
cgctcctgctcggagggctccatcgagtcctgcacgtgcgactaccggcggcgcggtcct
gggggccccgattggcactggggaggctgcagcgacaacatcgacttcggccgcctcttt
ggccgggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcgggccgcacgaccgtgttctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcgtgcacggtgcgcacgtgctggatgcggctacccacgctgcgc
gccgtgggcgacgtgctgcgggaccgcttcgacggcgcctcgcgcgtcctgtacggcaat
cgcggcaacaaccgtgcctcgcgggcggaactgctgcgcctcgagcccgaggaccccgct
cacaagcctccctccccccacgatctcgtctacttcgagaaatcgcccaacttctgcaca
tacagcggacgcctgggtacagcgggcacggcagggcgcgcctgcaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgtggccggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacactcgcgtactgcacgagtgcctgtga

KEGG   Delphinapterus leucas (beluga whale): 111174269
Entry
111174269         CDS       T05885                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111174269 (WNT5A)
   04390 Hippo signaling pathway
    111174269 (WNT5A)
   04150 mTOR signaling pathway
    111174269 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111174269 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111174269 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    111174269 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174269 (WNT5A)
   05205 Proteoglycans in cancer
    111174269 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111174269 (WNT5A)
   05226 Gastric cancer
    111174269 (WNT5A)
   05217 Basal cell carcinoma
    111174269 (WNT5A)
   05224 Breast cancer
    111174269 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111174269 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    111174269 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111174269 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111174269 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111174269 (WNT5A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111174269 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111174269
NCBI-ProteinID: XP_022428548
UniProt: A0A2Y9N641
LinkDB
Position
Unknown
AA seq 458 aa
MLKSLQQSSPQAEAGPRPSVHYLNCWSIPNMFHFTDSKAFLMSGVWRCLASVSADDSICV
HTPKCTHGLQRETMELHKLEKSVGILSPGVALGTAARAMSSKFFLMALAIFISFAQVVIE
GNSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIK
ECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTC
GCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHN
NEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRG
KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGR
GYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgttgaaatcactacagcagtcttctccacaggcagaggctggaccgaggccttctgta
cattatctcaattgttggagcatccctaatatgttccattttacagactcaaaagcattt
ttaatgagtggagtatggcgatgccttgccagcgtgtctgcagatgactcaatctgtgtg
cacacacccaaatgcacacacggtttgcaaagggaaaccatggagctccacaaattggag
aagtcggttggaatattaagcccaggagttgctttggggacggctgcaagggcaatgtct
tccaagttcttcctaatggctttggccatatttatctccttcgcccaggtcgtaatagaa
ggcaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagtatatatc
ataggagcacagcctctgtgcagccaactggcaggactttctcaaggacagaagaaacta
tgccacttgtatcaggaccacatgcagtacatcggagagggcgcaaagacaggcatcaaa
gaatgccagtatcagttccgacaccggaggtggaactgcagcaccgtggataacacctca
gtcttcggcagggtcatgcagataggcagccgcgagacggccttcacgtacgccgtgagc
gccgcgggggtggtcaacgccatgagccgcgcctgccgcgagggcgagctgtccacctgt
ggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctgtggggcggctgc
ggcgacaacatcgactacggctaccgcttcgccaaggagttcgtggacgcgcgcgagcgg
gagcgcatccacgccaagggctcctacgagagcgcgcgcatcctcatgaacctgcacaac
aacgaggccggccgcaggacggtgtacaacctggcggacgtggcctgcaagtgccacggg
gtgtcaggctcgtgcagcctcaagacgtgctggctgcagttggccgacttccgcaaggtg
ggcgacgccctgaaggagaagtacgacagcgcagcggccatgcggctcaacagccggggc
aagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtctacatc
gaccccagccccgactactgcgtgcgcaacgagagcaccggctcgctgggcacacagggc
cgcctgtgcaacaagacgtccgagggcatggacggctgtgagctcatgtgctgcggccgc
ggctacgaccagtttaagacggtgcagaccgagcgctgccactgcaagttccactggtgc
tgctacgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaagtag

KEGG   Delphinapterus leucas (beluga whale): 111176602
Entry
111176602         CDS       T05885                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111176602 (WNT5B)
   04390 Hippo signaling pathway
    111176602 (WNT5B)
   04150 mTOR signaling pathway
    111176602 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111176602 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111176602 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    111176602 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176602 (WNT5B)
   05205 Proteoglycans in cancer
    111176602 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111176602 (WNT5B)
   05226 Gastric cancer
    111176602 (WNT5B)
   05217 Basal cell carcinoma
    111176602 (WNT5B)
   05224 Breast cancer
    111176602 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111176602 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    111176602 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111176602 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111176602 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111176602 (WNT5B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111176602 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111176602
NCBI-ProteinID: XP_022432891
UniProt: A0A2Y9NIX6
LinkDB
Position
Unknown
AA seq 361 aa
MPSPPALLAAAAALFACWAPLRAAASSWWSLAMNPVQRPEVFIIGAQPVCSQLPGLSAGQ
RKLCQLYQEHMAYIGEGARTGIRECQHQFRQRRWNCSTVDDASVFGRVMQIGSRETAFTY
AVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVDYGYRFAKEFVDA
REREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKTADVACKCHGVSGSCSLKTCWLQLAEF
RKVGDQLKEKYDSAAAMRITRRGKLELVNSRFKQPTPEDLVYVDPSPDYCLRDQSTGSLG
TQGRLCNKTSEGLDGCALMCCGRGYDQFKSVQTERCHCKFHWCCFVRCKKCTQVVDQFVC
K
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcccagcccgcctgccctgctcgctgctgccgctgcgctgttcgcctgctgggccccg
cttcgggccgcggccagctcctggtggtctttggctatgaacccggtgcagaggcctgag
gtgttcatcatcggggcgcagcccgtgtgcagccaactccccgggctctccgctggccag
cggaagctgtgccagctgtaccaggagcacatggcctacataggcgagggggccaggacg
ggcatcagggagtgccagcaccagttccggcagcggcggtggaactgcagcaccgtggac
gatgcctccgtcttcgggagagtcatgcagatagggagccgggagacggccttcacctac
gccgtgagcgcggccggggtggtcaacgccatcagccgtgcctgccgcgagggggagctg
tccacgtgcggctgcagccgggccgcgcggcccaaggacctgccccgggactggctgtgg
ggcggctgcggcgacaacgtggactacggctaccgcttcgccaaggagttcgtggacgcc
cgcgagcgcgagaagaacttcgccaagggctcggaggagcagggccgcgtgctcatgaac
ctgcagaacaacgaggccggccggagggctgtgtataagacggcagacgtggcctgcaaa
tgccacggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggcggagttc
cgcaaggtgggggaccagctgaaggagaagtacgatagcgcggctgccatgcgcatcacc
cgccggggcaagctggagctggtcaacagccgcttcaagcagcccacccccgaggacctg
gtctacgtggaccccagcccggactactgcctgcgcgaccagagcacgggctcgctgggc
acgcagggccgcctgtgcaacaagacgtccgagggcctggacggctgtgcgctcatgtgc
tgcggccgcggctacgaccagttcaagagcgtgcagaccgagcgctgccactgcaagttc
cactggtgctgcttcgtccgctgcaagaagtgcacgcaggtcgtggaccagttcgtctgc
aagtag

KEGG   Delphinapterus leucas (beluga whale): 111179093
Entry
111179093         CDS       T05885                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111179093 (WNT16)
   04390 Hippo signaling pathway
    111179093 (WNT16)
   04150 mTOR signaling pathway
    111179093 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111179093 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111179093 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179093 (WNT16)
   05202 Transcriptional misregulation in cancer
    111179093 (WNT16)
   05205 Proteoglycans in cancer
    111179093 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111179093 (WNT16)
   05226 Gastric cancer
    111179093 (WNT16)
   05217 Basal cell carcinoma
    111179093 (WNT16)
   05224 Breast cancer
    111179093 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111179093 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    111179093 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111179093 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111179093 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111179093 (WNT16)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111179093 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111179093
NCBI-ProteinID: XP_022438118
UniProt: A0A2Y9P7C0
LinkDB
Position
Unknown
AA seq 362 aa
MDRAALLGLSRLCALWAALLTLFPCGAQGNWMWLGIASFGVPEKLGCASLPLNSRQKELC
KRKPYLLPSICEGARLGIQECRSQFRYERWNCLAAAAAPPDTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSAREGWHWGGCSDDVQYGMWFSRKFL
DFPIRNTTGKESKVLLAMNLHNNEAGRQAVAKLMSLDCRCHGVSGSCAVKTCWKTMSSFE
KIGRLLKDKYENSVQISDKIKRKMHRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagagcagcgctcctgggactgtcccgcctgtgcgcgctgtgggcagccctgctc
acgctgttcccctgcggagcccaaggaaactggatgtggctgggcatcgcctcctttggg
gttccggagaagctgggctgcgccagcttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatctgcgagggcgcccgtctgggcattcaggag
tgcaggagccagttcagatacgagagatggaactgcctggcggccgccgccgccccgcct
gacaccagccctctctttggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagtgcaggcaac
atgaccgagtgttcctgtgacaccacgttgcagaacggcggctcagcaagggaaggctgg
cactgggggggctgctctgatgatgtccagtatggcatgtggttcagcagaaagttccta
gatttccccatcagaaacaccacgggaaaagaaagcaaagtactgttagcaatgaaccta
cataacaatgaagctggaaggcaggctgtcgccaagttgatgtcattagactgccggtgt
cacggagtttccggctcctgtgctgtgaaaacatgctggaaaaccatgtcttcttttgaa
aagattggccgtctgttgaaggataaatatgaaaacagtgtccaaatctcagacaaaata
aagaggaaaatgcacaggagagagaaagatcagaggaaaataccgatccacaaggatgat
ctgctctacgttaataagtctcccaattactgtgtagaggataagaaactcgggatcccc
gggacccaaggcagagagtgcaaccgcacgtcagagggcgcagacggctgcaacctcctc
tgctgcggcaggggctacaacacccacgtggtcaggcacgtggagcgatgcgagtgcaag
tttatctggtgctgctacgtccgctgcaggaggtgtgaaagcatgactgatgtccacact
tgcaagtaa

KEGG   Delphinapterus leucas (beluga whale): 111179238
Entry
111179238         CDS       T05885                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111179238 (WNT2)
   04390 Hippo signaling pathway
    111179238 (WNT2)
   04150 mTOR signaling pathway
    111179238 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111179238 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111179238 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179238 (WNT2)
   05205 Proteoglycans in cancer
    111179238 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111179238 (WNT2)
   05226 Gastric cancer
    111179238 (WNT2)
   05217 Basal cell carcinoma
    111179238 (WNT2)
   05224 Breast cancer
    111179238 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111179238 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    111179238 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111179238 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111179238 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111179238 (WNT2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111179238 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111179238
NCBI-ProteinID: XP_022438322
UniProt: A0A2Y9P4P7
LinkDB
Position
Unknown
AA seq 360 aa
MNACLGGIWLWLPLLLTWLSPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKPCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSPDWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcctgtctcggtggaatctggctctggctccctctgctcttgacctggctcagc
cctgaggtcagctcttcatggtggtacatgagagctacaggcggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcggcagctgtgccaccgacacccggac
gtgatgcgtgccatcggcctgggtgtggccgagtggacggcagagtgccagcaccagttc
cgccagcaccgctggaactgcaacaccctggacagggatcacagcctcttcggcagggtc
ctgcttcgaagtagccgggaatctgcctttgtttacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaaccctgttcctgtgacccaaag
aagaagggaaccgccaaggacagcaagggcactttcgactggggtggctgcagtgataac
attgactatgggatcaagtttgcccgagcctttgtggacgccaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagccggcaggaaggctgtaaagcgg
ttcttgaaacaggagtgcaagtgtcatggcgtgagcggctcatgtaccttgaggacctgc
tggctggccatggccgacttcagaaaaacgggcgattatctctggaggaagtacaacgga
gccatccaagttgtcatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aaaaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatccgg
gaccgggatgcaggctccccgggtacagcaggccgtgtgtgcaacctgacttcccgaggc
atggacagctgcgaagtcatgtgctgtgggagaggctatgacacctcccgcgtcacccgg
atgaccaagtgcgagtgtaagttccactggtgctgtgctgtgcgctgccaggactgcctg
gaggccctggatgtgcacacgtgcaaggccccgaagagccccgactgggcggctcccaca
tga

KEGG   Delphinapterus leucas (beluga whale): 111180026
Entry
111180026         CDS       T05885                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111180026 (WNT2B)
   04390 Hippo signaling pathway
    111180026 (WNT2B)
   04150 mTOR signaling pathway
    111180026 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111180026 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111180026 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180026 (WNT2B)
   05205 Proteoglycans in cancer
    111180026 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111180026 (WNT2B)
   05226 Gastric cancer
    111180026 (WNT2B)
   05217 Basal cell carcinoma
    111180026 (WNT2B)
   05224 Breast cancer
    111180026 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111180026 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    111180026 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111180026 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111180026 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111180026 (WNT2B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111180026 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111180026
NCBI-ProteinID: XP_022439771
UniProt: A0A2Y9P3F6
LinkDB
Position
Unknown
AA seq 397 aa
MLRPGGAEEAAQLPFRRVRAPVSAPAPRPTSPDGSRASARLSLACRLLLLLLLLLLLLPA
RVDTSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHH
RWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRG
RHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLK
LECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRA
TRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQ
CECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgctgaggccgggtggtgcggaggaagccgcgcagctcccctttcggcgcgtccgcgcc
cctgtctccgcgcccgcgcctagacccacgagccccgacggctctcgggcttcggcccgc
ctaagtcttgcttgccgcctgctgctgctgctcctgctgctgctgctgctgctgccggcc
cgcgtagacacgtcctggtggtacatcggggcgctgggggcccgagtgatctgtgacaat
atccctggcctggtgagccggcagcggcagctgtgccagcgttacccagacatcatgcgc
tcggtgggcgagggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccat
cgctggaactgcaccaccctggaccgggaccacactgtctttggccgtgtcatgctcaga
agtagccgggaggcagcatttgtatatgccatctcatcagcaggggtggtccatgctatc
actcgtgcctgtagccagggtgaactgagtgtgtgcagctgtgacccctacacccgtggc
cgacatcatgaccaacgtggggactttgactggggtggctgcagtgacaacatccactat
ggtgttcgttttgccaaagccttcgtggatgccaaggagaagaggcttaaggatgcacgg
gctctcatgaacttacataacaatcgctgtggtcgcacggctgtgcggcggtttctgaag
ctggagtgtaagtgccatggcgtgagtggctcctgtactctgcgcacctgctggcgtgca
ctctcagacttccgccgcacaggtgattacctgcggcggcgctatgatggggctgtgcag
gtaacggccacccaggatggcgcaaacttcacagcagcccgccaaggctatcgccgtgct
acccggactgaccttgtctactttgacaactctccagactactgcgtcttggacaaggct
gcaggttccctaggcaccgcaggccgagtctgtagcaagacatctaaagggacagatggt
tgtgaaatcatgtgctgcggtcgagggtatgacacaactcgagttacccgtgtcacccag
tgtgagtgcaaattccactggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtg
gatgtccatacttgcaaggcccccaagaaggcagagtggctggatcagacctga

KEGG   Delphinapterus leucas (beluga whale): 111182565
Entry
111182565         CDS       T05885                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111182565 (WNT8A)
   04390 Hippo signaling pathway
    111182565 (WNT8A)
   04150 mTOR signaling pathway
    111182565 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111182565 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111182565 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182565 (WNT8A)
   05205 Proteoglycans in cancer
    111182565 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111182565 (WNT8A)
   05226 Gastric cancer
    111182565 (WNT8A)
   05217 Basal cell carcinoma
    111182565 (WNT8A)
   05224 Breast cancer
    111182565 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111182565 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    111182565 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111182565 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111182565 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182565 (WNT8A)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111182565 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111182565
NCBI-ProteinID: XP_022444715
UniProt: A0A2Y9PFS1
LinkDB
Position
Unknown
AA seq 398 aa
MRRAVDFFPLGHSAFPYINTEKDPALSSLLWTWPWARLGPLGVGRAMGDLFMLRVAVGIC
YATFSTSAWSVNNFLITGPKAYMTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLST
HNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNGKTGGHGWIWGGCSD
NVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTC
WLQLANFREMGNYLKAKYDQALKIEMDKRRLRAGNSAEGHWAPTEAFLPSAEAELIFLEE
SPDYCTRNSSLGIYGTEGRECLQNSHNTSRWEQCSCGSLCTECGLQVEEKRTEAISSCNC
KFQWCCTVKCDQCRHVVSKYYCTHSPGSAWSQGKGSTR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgagaagagctgttgattttttcccccttggccattcagcatttccctacataaatact
gagaaagatcctgccctctcctcacttctctggacttggccctgggctagacttggtccc
ctgggggtgggaagggccatgggggacttgtttatgctcagggtggctgtgggcatatgc
tatgcaaccttcagtacctctgcctggtcagtgaacaatttcctgataacaggtcccaag
gcctatatgacctacaccaccagtgtggccctgggtgcccagagtggcattgaggagtgt
aagttccaatttgcttgggaacgctggaactgccctgaaaatgctctccagctttccact
cacaacaggctgagaagtgccaccagggagacttccttcattcatgctatcagctctgct
ggagtcatgtacaccatcaccaagaactgtagcatgggcgactttgaaaactgtggctgt
gatgagtcaaaaaatggaaaaacaggaggccatggctggatctggggaggctgcagcgac
aatgtagagtttggggaaagaatctccaaactcttcgtggacagtctggagaaggggaag
gatgccagagccctgatgaatcttcataacaacagggcaggcaggctggcagtgagagcc
accatgaaaaggacttgcaaatgtcatggcatctcggggagctgtagcatccagacatgc
tggctgcagctggctaacttccgggagatgggcaactacctaaaggccaagtatgaccag
gcactgaaaattgagatggataagcggcggctaagggctgggaacagtgccgagggccac
tgggcacccactgaggccttccttcctagtgcagaagctgagctgatcttcttagaggaa
tcgcctgattactgcacccgcaactccagcttgggcatctatggcacagagggtcgggag
tgtctgcagaacagccacaatacatccaggtgggagcaatgcagctgcgggagcttgtgt
acagagtgtggcctgcaggtggaagagaagagaactgaggctataagcagctgtaactgc
aaattccagtggtgctgcacggttaaatgtgaccagtgtaggcatgtggtgagcaagtac
tactgcacgcactccccaggcagtgcttggtcccagggcaagggcagcacacgatag

KEGG   Delphinapterus leucas (beluga whale): 111182576
Entry
111182576         CDS       T05885                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111182576 (WNT3)
   04390 Hippo signaling pathway
    111182576 (WNT3)
   04150 mTOR signaling pathway
    111182576 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111182576 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111182576 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182576 (WNT3)
   05206 MicroRNAs in cancer
    111182576 (WNT3)
   05205 Proteoglycans in cancer
    111182576 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111182576 (WNT3)
   05226 Gastric cancer
    111182576 (WNT3)
   05217 Basal cell carcinoma
    111182576 (WNT3)
   05224 Breast cancer
    111182576 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111182576 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    111182576 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111182576 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111182576 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182576 (WNT3)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111182576 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111182576
NCBI-ProteinID: XP_022444720
UniProt: A0A2Y9PFS7
LinkDB
Position
Unknown
AA seq 453 aa
MPFPEPDSWAGREGRVIDRLNYRLISYLRPRALIGCSLTSSNPAAPRWAREGGSCGWRCA
SDKPESHFQSQVDFVPTIGGVAPPLHGRGQTSSSAPLLMEPHLLGLLLGLLLCGTRVLAG
YPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQH
QFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCD
SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHM
HLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAK
YALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTR
TEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcccttcccggagcccgactcgtgggccgggcgggaggggcgcgtgattgacaggctg
aactacagactcatctcttaccttaggccgcgggcgctgattggctgctcgctgacatcc
tcaaacccggctgctccgcgctgggctcgggaggggggcagctgcgggtggaggtgcgct
tctgacaagcccgaaagtcatttccaatctcaagtggactttgttccaactattgggggc
gtcgctccccctcttcatggtcgcgggcaaacttcctcctcggcgccgcttctaatggag
ccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctcgccggc
tacccaatttggtggtccctggccctgggccagcagtacacatccctgggctcacagccc
ctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgcaattac
atcgaaatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgccagcac
cagttccggggccgccgctggaactgcaccaccatcgacgacagcctggccatcttcggg
cccgtcctcgacaaagccacccgcgaatcggccttcgtgcacgccatcgcctcagccggc
gtggccttcgccgtcacacgctcctgtgccgagggcacctccaccatctgtggctgcgac
tcgcatcataaaggaccgcccggggaaggctggaagtggggaggctgcagcgaggacgcc
gacttcggggtgcttgtgtcccgggagttcgcggacgcacgtgagaacaggccggacgcg
cgctcggccatgaacaagcacaacaacgaggctggccgcacgaccatcctggaccacatg
cacctcaagtgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgctggtgg
gcccagcccgacttccgcgccatcggggacttcctcaaggacaagtacgacagcgcctcg
gagatggtggtggagaagcaccgggagtcccgtggctgggtggagaccctccgcgccaag
tacgcgctcttcaagccgcccactgagagggacctggtctactacgagaactcccccaac
ttttgcgagcccaaccctgagacgggctccttcggcaccagggaccggacttgcaatgtc
acctcccacggcatcgatggctgcgacctgctctgctgcggccgtggccacaacacaagg
acggagaagcggaaggagaaatgccactgcatcttccactggtgctgctacgtgagctgc
caggagtgtatccgcatctacgatgtgcacacctgcaagtag

KEGG   Delphinapterus leucas (beluga whale): 111182925
Entry
111182925         CDS       T05885                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111182925 (WNT9B)
   04390 Hippo signaling pathway
    111182925 (WNT9B)
   04150 mTOR signaling pathway
    111182925 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111182925 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111182925 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182925 (WNT9B)
   05205 Proteoglycans in cancer
    111182925 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111182925 (WNT9B)
   05226 Gastric cancer
    111182925 (WNT9B)
   05217 Basal cell carcinoma
    111182925 (WNT9B)
   05224 Breast cancer
    111182925 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111182925 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    111182925 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111182925 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111182925 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182925 (WNT9B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111182925 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111182925
NCBI-ProteinID: XP_030618010
LinkDB
Position
Unknown
AA seq 358 aa
MRPPPALALAALCLLALPAAAAAAYFGLTGREVLTPFPGLGTAPAPAQGGAHLKQCDLLK
LSRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHERWNCSLEGRTGLLKRGFKETAFL
YAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLNNFLGP
KRGSKDLRARVDAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLK
LRHDSAVKVSSATNEALGRLELWAPARAGSSTKGPAPRPGDLVYMEDSPSFCRRSKYSPG
TAGRVCSREASCGSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgcgctctgcctgctggcgctgcccgccgcc
gccgccgccgcctacttcggcctaaccgggcgggaggtcctgacacccttcccgggtctg
ggcaccgcccctgccccagcacagggtggggcccacctgaagcagtgtgacctcctgaag
ctgtcccgccggcagaagcagctctgccggcgggagccaggcctggctgagaccctgcag
gatgccgcacacctcagcctgctcgagtgccagtttcagttccggcatgagcgctggaac
tgcagcctagaggggaggacgggactgctcaagagaggtttcaaggagacggctttcctg
tatgcggtgtcctcggccgccctcacgcacactctggcccgggcctgcagcgccgggcgc
atggagcgttgcacctgtgatgactctccaggcctggagagccggcaggcctggcagtgg
ggcgtgtgcggcgacaacctcaagtacagcaccaagttcctgaacaacttcctggggccc
aagagaggaagcaaagacctgcgggcacgggtagacgcccacaacacccacgtgggcatc
aaggccgtgaagagtggcctcaggaccacgtgtaagtgccacggcgtgtcgggctcctgc
gccgtgcgcacctgctggaagcagctctccccattccgcgagacaggccaggtgttaaag
ctgcgccacgactcagccgtcaaggtgtccagtgccaccaacgaggccttgggccgcctg
gaactgtgggcaccagccagagcaggcagctccaccaagggcccggccccacggcctggg
gacctggtctacatggaggactcacccagtttctgccggcgcagcaagtactcgcccggc
acagcgggcagggtgtgctcccgggaggccagctgcggcagcctatgctgtgggcggggc
tatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgttgc
tacgtggagtgccagcagtgcgtgcaggaggagcttgtgtacacctgtaagcattag

KEGG   Delphinapterus leucas (beluga whale): 111184814
Entry
111184814         CDS       T05885                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111184814 (WNT11)
   04390 Hippo signaling pathway
    111184814 (WNT11)
   04150 mTOR signaling pathway
    111184814 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111184814 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111184814 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184814 (WNT11)
   05205 Proteoglycans in cancer
    111184814 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111184814 (WNT11)
   05226 Gastric cancer
    111184814 (WNT11)
   05217 Basal cell carcinoma
    111184814 (WNT11)
   05224 Breast cancer
    111184814 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111184814 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    111184814 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111184814 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184814 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111184814 (WNT11)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111184814 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111184814
NCBI-ProteinID: XP_022449449
UniProt: A0A2Y9PRI0
LinkDB
Position
Unknown
AA seq 354 aa
MRARPQVCQALLFALALQTNVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggcctcaggtctgccaggcgctgctcttcgccctggcgctccagaccaat
gtgtgctatggcatcaagtggctggcgctctccaagaccccggcggccctggcactgaac
cagacgcagcactgcaagcagctggagggcctggtgtccgcgcaggttcagctgtgccgc
agcaacctggagctcatgcacaccatcgtgcacgccgcccgcgaggtcatgaaggcctgc
cgccgggccttcgcggacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgcttgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctctctggaaatgaagtgtaagtgccacggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcgggatgtggctgccgacctcaagacccgc
tacctgtcggccaccaaggtggtgcaccgacccatgggcacccgcaagcaccttgtgccc
aaggacctggacatccggcctgtgaaggactcggagctcgtctatctgcagagctcccct
gacttctgcatgaagaacgagaaggtgggctcccatgggacgcaggacaggcagtgcaac
aagacgtcgcatggcagtgacagctgtgacctcatgtgctgtggacgcggctacaacccc
tacacagaccgtgtggtcgagcggtgccactgcaagtaccactggtgctgctatgtcacc
tgccgcaggtgtgagcgcacggtggagcgctacgtctgcaagtga

KEGG   Delphinapterus leucas (beluga whale): 111186418
Entry
111186418         CDS       T05885                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04150  mTOR signaling pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111186418 (WNT7B)
   04390 Hippo signaling pathway
    111186418 (WNT7B)
   04150 mTOR signaling pathway
    111186418 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111186418 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111186418 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186418 (WNT7B)
   05205 Proteoglycans in cancer
    111186418 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111186418 (WNT7B)
   05226 Gastric cancer
    111186418 (WNT7B)
   05217 Basal cell carcinoma
    111186418 (WNT7B)
   05224 Breast cancer
    111186418 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111186418 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    111186418 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111186418 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111186418 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111186418 (WNT7B)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111186418 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 111186418
NCBI-ProteinID: XP_022452711
UniProt: A0A2Y9Q5D8
LinkDB
Position
Unknown
AA seq 356 aa
MAQPPSLDHAQKLSQVDFLRVSLLWRSLREARSAVLRRGPGSQHHLQQDPWLGPAAACHL
PEPARCHHRDRGGGADGHRRVPVPVPLRTLELLRPRREDCLRARAPRSREAAFTYAITAA
GVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIK
KNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYN
VAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRL
CNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgcagcccccctccctggatcatgcacagaaactttcgcaagtggattttctacgt
gtttctctgctttggcgttctctacgtgaagctcggagcgctgtcctccgtcgtggccct
gggagccaacaccatctgcaacaagatccctggcttggccccgcggcagcgtgccatctg
ccagagccggcccgatgccatcatcgtgatcggggagggggcgcagatgggcatcgacga
gtgccagtaccagttccgcttcggacgctggaactgctccgccctcggcgagaagactgt
cttcgggcaagagctccgaggagccgggaggccgccttcacgtacgccatcaccgccgcc
ggcgtggctcacgccgtcaccgccgcctgcagccagggcaacctgagcaactgcggctgc
gaccgcgagaagcagggctactacaaccaggccgagggctggaagtggggcggctgctcc
gccgacgtgcgctacggcatcgacttctcccggcgcttcgtggacgcccgcgagatcaag
aaaaacgccaggcgcctcatgaacctgcacaacaatgaggcgggcaggaaggtcctggag
gagcgcatgaagctggagtgcaagtgccacggcgtgtcaggctcgtgcaccaccaagacg
tgctggaccacgctgcccaagttccgcgaggtgggccatctgctcaaggagaagtacaac
gtggcggtgcaggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgc
atcaaacagctgcgcagctaccagaagcccatggagacggacctggtgtacatcgagaag
tcgcccaactactgcgaggaggacgcggccacgggcagcgtgggcacccagggccgcctg
tgcaaccgcacgtcgcccggcgccgacggctgcgacaccatgtgctgcggccgcggctac
aacacccaccagtacaccaaggtctggcagtgtaactgcaagttccactggtgctgcttc
gtcaagtgcaacacgtgcagcgagcgcaccgaggtcttcacctgcaagtga

DBGET integrated database retrieval system