KEGG   Delphinapterus leucas (beluga whale): 111163373
Entry
111163373         CDS       T05885                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04110  Cell cycle
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111163373 (E2F2)
   04218 Cellular senescence
    111163373 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163373 (E2F2)
   05206 MicroRNAs in cancer
    111163373 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111163373 (E2F2)
   05225 Hepatocellular carcinoma
    111163373 (E2F2)
   05226 Gastric cancer
    111163373 (E2F2)
   05214 Glioma
    111163373 (E2F2)
   05220 Chronic myeloid leukemia
    111163373 (E2F2)
   05218 Melanoma
    111163373 (E2F2)
   05219 Bladder cancer
    111163373 (E2F2)
   05215 Prostate cancer
    111163373 (E2F2)
   05224 Breast cancer
    111163373 (E2F2)
   05222 Small cell lung cancer
    111163373 (E2F2)
   05223 Non-small cell lung cancer
    111163373 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111163373 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111163373 (E2F2)
   05161 Hepatitis B
    111163373 (E2F2)
   05160 Hepatitis C
    111163373 (E2F2)
   05163 Human cytomegalovirus infection
    111163373 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163373 (E2F2)
   05169 Epstein-Barr virus infection
    111163373 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111163373 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111163373 (E2F2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    111163373 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA
Other DBs
NCBI-GeneID: 111163373
NCBI-ProteinID: XP_022407711
UniProt: A0A2Y9LG61
LinkDB
Position
Unknown
AA seq 437 aa
MLRGPRALAPAAGPPPKGLPAMSPTELWPPGLSSPQLCPATTTYYTQLYPQTVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGKPVVPEFRTPKRKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMSMEQTLDQLIQSCSLHFKHLTE
DKANKRLAYVTYQDIRAVGSFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEVQEPNSPAKEPLPSTSTLSPSPDPTQPSSSINPGITESTASSAPALTSQQVLPP
LPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLPCSSPLISFSPPLDQDDYLWGLDGGE
GISDLFDTYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcgagggccgcgggccctggctccggccgcggggccaccccccaaggggctgccc
gcgatgagccccacggagctgtggccgcccggcctcagcagccctcagctctgcccggcc
accaccacctactacacccagctgtacccgcagactgtgcctcccgctgcggcgccgggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgcctgct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaagcctgtggtccct
gaattccggactcccaagcggaagtgcattagagtggatggcctccccagccccaaaacc
cccaagtcgcctggggagaagactcgctatgacacgtcgctggggctgctcaccaagaaa
ttcatttacctcctgagcgagtctgaggatggggtcctggaccttaactgggctgctgag
gtgctggacgtgcagaagcggcgcatctacgacataaccaatgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcagaggactgtttgaagac
cccacccggcccgggaagcagcagcaactggggcaggagctgaaggagctaatgagcatg
gagcagaccttggaccagctcatccagagctgctctctgcacttcaagcacctgacggag
gacaaggccaacaagagactggcctacgtgacttaccaggacatccgtgctgtgggcagc
tttaaggagcagaccgtgatcgctgtcaaggcccctccgcagacgagactggaagtgcct
gacaggagcgaggagaacctgcagatatatctgaagagcacgcaggggcccatcgaagtc
tacctttgcccagaagaggtgcaggagcccaacagtcctgccaaggagcccctcccctcc
acctccaccctcagtcccagccctgaccccacccagcccagcagcagcatcaaccctgga
atcacggaatccacggcatcctcagcaccagcgctgacgtcccagcaggtcctgccacca
ctcccgccgtcccttgtccccctggaggccaccgacagcatgctggagctgccacaccca
ctcctgcagcagacggaggaccagttcctgtccccgacactgccatgcagctcccctctg
atcagcttctccccacccttggaccaggacgactacctgtggggcctggacggcggggag
ggcatcagtgacctcttcgacacctatgaccttggggacctgctgattaactga

KEGG   Delphinapterus leucas (beluga whale): 111181407
Entry
111181407         CDS       T05885                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X2
  KO
K06620  transcription factor E2F3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04110  Cell cycle
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111181407 (E2F3)
   04218 Cellular senescence
    111181407 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181407 (E2F3)
   05206 MicroRNAs in cancer
    111181407 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111181407 (E2F3)
   05225 Hepatocellular carcinoma
    111181407 (E2F3)
   05226 Gastric cancer
    111181407 (E2F3)
   05214 Glioma
    111181407 (E2F3)
   05220 Chronic myeloid leukemia
    111181407 (E2F3)
   05218 Melanoma
    111181407 (E2F3)
   05219 Bladder cancer
    111181407 (E2F3)
   05215 Prostate cancer
    111181407 (E2F3)
   05224 Breast cancer
    111181407 (E2F3)
   05222 Small cell lung cancer
    111181407 (E2F3)
   05223 Non-small cell lung cancer
    111181407 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111181407 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111181407 (E2F3)
   05161 Hepatitis B
    111181407 (E2F3)
   05160 Hepatitis C
    111181407 (E2F3)
   05163 Human cytomegalovirus infection
    111181407 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111181407 (E2F3)
   05169 Epstein-Barr virus infection
    111181407 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111181407 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111181407 (E2F3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    111181407 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 111181407
NCBI-ProteinID: XP_022442468
UniProt: A0A2Y9PII7
LinkDB
Position
Unknown
AA seq 461 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPSFPAAATAAAAAAPSAYI
QILTTNTSTTSCSSSLQSGAIAAGPLLPSAPGVEQTAGSLLYTTPHGPSSRAGLLQQPPA
LGRGGSGGGGGPPAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKKKTRYDTSLG
LLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGC
SLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDI
RKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTN
NQDHNGNISKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVN
LLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccagcttccccgccgccgccaccgccgctgctgccgccgccccgagcgcgtacatc
cagatcctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgcc
atcgccgccggccccctcctccccagtgcccccggcgtggagcagaccgccggcagcctc
ctctacaccacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcg
ctgggacgcggcggcagcggcggcggcggcggccctccggcaaagcgcaggctggagcta
ggagaaagcggtcagcagtacctctcagatggtttaaaaacccccaagggcaaaggaaga
gctgcgctccgaagtccagatagtccaaaaaaaaaaacacggtatgatacatcacttggt
ctgctcaccaagaagttcattcagctactgagccaatcacctgatggggtcttggatttg
aacaaggcagcagaggtgctgaaggtgcaaaagagaaggatttatgacatcaccaatgta
ctggaaggcatccacctcattaagaagaagtctaaaaacaacgtgcagtggatgggctgc
agtctgtctgaggacgggggcatgctggcccagtgtcaaggcctgtctaaagaagtgacc
gagctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctc
aaactgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatatt
cgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaaca
agacttgaagtgcctgacccaatagagagcctacaaatacatttggcaagtacccaagga
cccattgaggtttatttgtgtccagaagagactgaaacacacagtccaatgaaaacaaac
aaccaagaccacaatgggaatatctctaaacccacttccaaagacttggcttcaaccaac
tcaggacatagtgattgctcgatttctatggcaaacctttctcctttggcctccccagcc
aaccttttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaac
ttactgccccccctgctccaagaagactatctcctaagccttggggaggaggaaggcatc
agcgatctctttgatgcttacgatctggaaaagctcccgctggtggaagacttcatgtgt
agctga

KEGG   Delphinapterus leucas (beluga whale): 111184273
Entry
111184273         CDS       T05885                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1 isoform X1
  KO
K17454  transcription factor E2F1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04110  Cell cycle
dle04137  Mitophagy - animal
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111184273 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    111184273 (E2F1)
   04218 Cellular senescence
    111184273 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184273 (E2F1)
   05206 MicroRNAs in cancer
    111184273 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111184273 (E2F1)
   05225 Hepatocellular carcinoma
    111184273 (E2F1)
   05226 Gastric cancer
    111184273 (E2F1)
   05214 Glioma
    111184273 (E2F1)
   05220 Chronic myeloid leukemia
    111184273 (E2F1)
   05218 Melanoma
    111184273 (E2F1)
   05219 Bladder cancer
    111184273 (E2F1)
   05215 Prostate cancer
    111184273 (E2F1)
   05224 Breast cancer
    111184273 (E2F1)
   05222 Small cell lung cancer
    111184273 (E2F1)
   05223 Non-small cell lung cancer
    111184273 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111184273 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111184273 (E2F1)
   05161 Hepatitis B
    111184273 (E2F1)
   05160 Hepatitis C
    111184273 (E2F1)
   05163 Human cytomegalovirus infection
    111184273 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111184273 (E2F1)
   05169 Epstein-Barr virus infection
    111184273 (E2F1)
   05165 Human papillomavirus infection
    111184273 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111184273 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111184273 (E2F1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    111184273 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 111184273
NCBI-ProteinID: XP_022448372
UniProt: A0A2Y9PYG0
LinkDB
Position
Unknown
AA seq 437 aa
MAVAGAPTGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAGPAAPAAGPRD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHAAVGIGGRLEGLTQDLQQLQESERQLDHLIHMCTTQLRLLSEDADS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ESAGGISPGKTSSQGAASGEEDRAADPATTVPPPPSSPPSSPATDPSQSLLSLEQEPLLS
RMGSLRAPMEEDRLSPLVAADSLLEHVREDFASLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtggccggggcccccacgggcggcccttgcgcgccggcgctggaggccctcctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccacggcgcag
gacgccagcgccccgccggcccccgccggccccgccgcgcccgccgccgggccccgcgac
cccgacctgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctggacttggaaactgaccatcagtac
ctggccgagagcagtgggccagctcggggcagaggccgccacccaggaaaaggtgtgaaa
tccccaggggagaagtcacgctatgaaacatcgctgaatctgactaccaagcgcttcctg
gagttgctgagccgctcggccgatggtgtcgtcgacctgaactgggcagctgaggtgctg
aaggtgcagaaacggcgcatctatgacatcaccaacgtccttgagggcatccagctcatc
gccaagaagtccaagaaccacatccagtggctaggcagccatgcagcagtggggatcggt
gggcggcttgaaggattgacccaggacctccagcaactgcaggaaagcgagcggcagctg
gaccacctgatccacatgtgtaccacgcagctgcgtctgctttccgaggatgctgacagc
cagcgcctggcctacgtgacctgccaggaccttcgtagcattgcggaccctgcagaacag
atggttatggtgatcaaggcccctcccgagacccagcttcaagccgtggactcctcagag
acctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagagtgcgggcgggatcagccccgggaagacctcgtcccagggtgcagcttctggggag
gaggacagggcagctgaccctgccaccacagtgccaccaccgccatcatctcccccctca
tccccagccacggatcccagtcagtccctgctaagcctggagcaagaacctctgctttcc
cggatgggcagcctgcgggcccccatggaagaggaccgcctgtccccactggtggcggct
gactcgctcctggagcacgtgcgggaggacttcgccagcctcctccccgaggagttcatc
agcctgtcccccccgcacgaggccctcgactaccacttcggccttgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcactcccctggatttctga

DBGET integrated database retrieval system