KEGG   Delphinapterus leucas (beluga whale): 111163479
Entry
111163479         CDS       T05885                                 

Gene name
USP7
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 7
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle05169  Epstein-Barr virus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111163479 (USP7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111163479 (USP7)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111163479 (USP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111163479 (USP7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111163479 (USP7)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     111163479 (USP7)
Peptidases and inhibitors [BR:dle01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   111163479 (USP7)
Ubiquitin system [BR:dle04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    111163479 (USP7)
SSDB
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Other DBs
NCBI-GeneID: 111163479
NCBI-ProteinID: XP_022407900
UniProt: A0A2Y9LE83
LinkDB
Position
Unknown
AA seq 1102 aa
MNHQQQQQQQKAGEQQLSEPEDXEMEAGDADDPPRITQNPVINGNVAMSDGHNNTEEDME
DDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNI
FESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
SLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGSKTMIELSDNENPWTI
FLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLN
SQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREV
MKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgaaccaccagcagcagcagcagcagcagaaagcgggcgagcagcagctgagcgagccc
gaggacnnggagatggaagctggagatgcagatgacccaccaagaattactcaaaaccct
gttatcaacgggaatgtagccatgagtgatgggcacaacaacacagaggaagacatggag
gacgacacgagttggcgctccgaggcaacctttcagttcactgtcgagcgcttcagcaga
ctgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagattatg
gtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctccag
tgcaatgctgaatctgattccacgtcttggtcctgtcacgcacaagcggtgctgaagatc
ataaattacagagatgatgagaagtcgttcagccggcgtatcagtcatttgttcttccat
aaagagaacgattggggattttccaatttcatggcctggagtgaagtgactgatcctgag
aaaggatttatagatgatgacaaagttacttttgaagtctttgtacaggcggatgccccc
catggagttgcgtgggattcaaagaagcacacgggctatgtcggtttaaagaatcaggga
gcgacttgttacatgaacagcctgctgcagactttatttttcacaaaccaactgcgaaag
gctgtgtacatgatgccgacagagggcgacgattcatccaaaagcgtccctttagcattg
caaagagtgttctatgaattacagcacagtgataagcccgtaggaacaaagaagctgacc
aagtcgttcgggtgggaaacgttagatagcttcatgcaacatgatgttcaagagctctgt
cgagtgttgcttgataatgtggaaaataagatgaaaggcacgtgtgtagaaggcaccata
cctaaattattcagaggcaagatggtgtcatatatccagtgtaaagaagtagactaccga
tctgatagaagagaagattattatgatatccagctaagtataaaaggaaagaaaaatata
tttgaatcatttgtggattacgtggcagtagaacaactagacggtgacaataaatacgat
gccggggagcatggcttgcaggaagcagagaaaggtgtgaaattcctaacattgccacca
gtgttacacctacaactgatgcgatttatgtatgaccctcagacggaccaaaatatcaag
atcaacgataggtttgagttccccgaacagctaccacttgatgaatttttgcaaaaaacg
gatcctaaagaccctgcaaattatattcttcatgcagtcctggttcatagtggagataat
catggtggacattatgtggtttatctaaaccctaaaggggatggcaaatggtgtaagttt
gacgatgacgtggtgtccaggtgtacgaaagaggaggccatcgagcacaactacgggggc
cacgacgacgacctctccgtgcggcactgcaccaacgcctacatgctggtttacatccgg
gagtcgaagctcagtgaggttttacaagctgtcaccgaccatgatatccctcagcagttg
gtggaacgattacaagaagagaaaaggatcgaggctcagaagcggaaggagcggcaggaa
gcccatctctacatgcaagtgcagattgttgcagaggaccagttttgtggccatcaagga
aatgatatgtacgatgaagaaaaagtgaaatacactgtgttcaaagtgttgaaaaactcc
tcgcttgctgagtttgtccagaacctctctcagaccatgggatttcctcaagatcagatt
cgactgtggcccatgcaggcgaggagcaatggcaccaaacgaccggccatgctggataac
gaggccgacggcagcaagacgatgattgaactcagtgataatgaaaacccttggacaata
ttcctggaaacagttgatccggagctggctgctagtggagcaacgttacccaagtttgat
aaagatcatgatgtgatgttatttttgaagatgtacgatcccaaaacacggagcttgaat
tactgtgggcatatctacacaccaatatcctgtaaaatacgtgacttgctgccagttatg
tgtgacagagcaggatttatccaagatactagtcttatcctctatgaggaagttaaaccg
aatttaacagagagaattcaggactatgacgtgtctcttgataaagccctcgacgagcta
atggatggtgacattatagtgtttcagaaggatgaccccgaaaatgataacagtgaatta
cccactgcaaaggaatatttcagagatctctaccaccgtgtcgatgtgattttctgtgat
aaaacaatccccaatgatcctggatttgtggttacattatcaaatagaatgaattatttt
caggtggcaaagacagttgctcagaggctcaacaccgacccgatgctgctccagttcttc
aagtctcaaggttatagggatggcccaggtaatcctcttagacataattatgaaggtact
ttaagagatcttctacagttcttcaagcctagacaacctaagaaactttactatcagcag
cttaagatgaaaatcacggactttgagaacaggcgaagttttaagtgtatatggttaaac
agccaatttagggaagaggaaataacactatatccagacaagcacgggtgtgtccgggac
ctgttagaggaatgtaaaaaggctgtggaactcggcgagaaggcatcagggaaacttagg
ctgctagaaatcgtaagctacaaaattattggtgtgcatcaagaagacgaactcctagaa
tgtttatctcctgcgacaagtcgaacgtttcgaatagaggaaatacctttggaccaggta
gacatagataaggaaaatgagatgctgatcacagtggcacatttccacaaagaggtgttt
gggacattcgggatcccgttcttgctgaggatacaccagggcgagcatttcagagaagtg
atgaagcggattcagagtctgctagacatccaggaaaaggagtttgaaaagtttaaattt
gccattgtgatgatgggccgacaccagtacataaatgaagatgagtatgaagtaaacttg
aaagactttgaacctcagcctggtaacatgtctcatcctcggccttggctagggctcgac
cacttcaacaaagccccaaagaggagtcgctacacatacctggaaaaggcgattaaaatc
cataactga

DBGET integrated database retrieval system