KEGG   Delphinapterus leucas (beluga whale): 111163537
Entry
111163537         CDS       T05885                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04380  Osteoclast differentiation
dle04630  JAK-STAT signaling pathway
dle04910  Insulin signaling pathway
dle04917  Prolactin signaling pathway
dle04930  Type II diabetes mellitus
dle04935  Growth hormone synthesis, secretion and action
dle05145  Toxoplasmosis
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111163537 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163537 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111163537 (SOCS1)
   04917 Prolactin signaling pathway
    111163537 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    111163537 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111163537 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111163537 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111163537 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111163537 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111163537 (SOCS1)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111163537 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111163537
NCBI-ProteinID: XP_022408002
UniProt: A0A2Y9LE91
LinkDB
Position
Unknown
AA seq 215 aa
MVAHNQVAADNAISTAAEPRRRPEPSSSSSSSSSSSPAAPARPRPCPAAPAPTPGETHFR
TFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPPRMLGAPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcaatctccacggcagcagagccccga
cggcggccagagccttcctcctcttcctcctcttcttcctcctcctcgcccgcggcccct
gcgcgcccgcggccctgcccggctgctccggctccgaccccgggcgagacgcacttccgc
acgttccgctcgcacgccgactaccggcgcatcacccgggccagcgcgctcctggacgcc
tgcggcttctactggggacccctgagcgtgcacggggcgcacgagcggctgcgcgccgag
cccgtgggcacctttctggtgcgcgacagccgccagcggaactgcttctttgccctcagc
gtgaagatggcctcgggccccacgagcatccgcgtgcacttccaggccggccgcttccac
ctggacggcagccgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcg
gcgccgccccgcatgctgggggccccgctgcgccagcgccgcgtgcggccgcttcaggag
ctgtgccgccagcgcattgtggccaccgtgggccgcgagaacctggcgcgcatccccctc
aaccccgtcctccgggactacttgagctccttccccttccagatctga

KEGG   Delphinapterus leucas (beluga whale): 111163600
Entry
111163600         CDS       T05885                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04910  Insulin signaling pathway
dle04917  Prolactin signaling pathway
dle04930  Type II diabetes mellitus
dle04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163600 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111163600 (SOCS2)
   04917 Prolactin signaling pathway
    111163600 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    111163600 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111163600 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111163600 (SOCS2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111163600 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 111163600
NCBI-ProteinID: XP_022408149
UniProt: A0A2Y9LEZ1
LinkDB
Position
Unknown
AA seq 198 aa
MTLRCLEPSGNGAEGTQSHWGTSGSAEEPSPEAARLAKALRELSHTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcagagccattgg
gggacctcggggtcggcggaggagccgtccccggaggcggcgcgtctggcgaaggccctg
cgggaacttagtcacacaggttggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagttcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgcatcgaataccaa
gatgggaaatttagattggactctatcatatgtgtcaagtccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacgggccca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacatcagca
ccacctctgcagcatctctgtagactcaccattaacaaatgtaccggtaccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Delphinapterus leucas (beluga whale): 111166263
Entry
111166263         CDS       T05885                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7 isoform X1
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166263 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111166263 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111166263 (SOCS7)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111166263 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 111166263
NCBI-ProteinID: XP_022413492
UniProt: A0A2Y9M2L1
LinkDB
Position
Unknown
AA seq 641 aa
MQGAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPGHGPAPPPFLARPGPRGSR
PPQLMVFRNVGRPPEEEDAEAAREPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGL
EAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLV
LEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFLVQDLVPPGRLS
RGEQQQPPPPPPPPGPLRPLAGPSRKSSLKVRLSRLFRTKSCNGGSGGGDGAGKRPSGEL
GASAASLTDVGGFAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLT
SPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAP
LRAAESLHSQPPPPLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGS
FLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMH
SKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLP
KPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVLEPST
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgcagggggccgagctccgggatggtgaggcggcggcggcggccgcttcgtaccgcgtc
ctgagccgcctgctcggctatggagaggcggcccccgagccaggcccgccgccgccgcct
ccgggccatggccccgcgccgccacccttcctcgcgcggccgggcccgcggggctcccgg
ccgcctcagctgatggtgttccgcaacgtgggtcggccgccggaggaggaggacgcggag
gcggcccgggagccgggaccctcggaactgctgtgtcctcggcaccgctgtgccctggac
cccaaggccctgccgccggggttggcgctcgagcggacctggggcccggcggctggacta
gaggcgcagttggcggctctggggctcgggcagcctgcggggcccggggtcaagacggtc
ggcggtggttgctgcccgtgcccgtgccccccgcagccgccccctccgcagccccagccg
cctgctgccgccccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtc
ctggaaggcttggagtcggaggccgagagcctggagactaacagctgctcggaagaggag
ctcagcagcccgggccgcggaggaggagggggcggccggcttcttctgcagcccccgggc
cctgaattacccccggtgcccttcctggtgcaggacttggtccctccagggcgcttgagt
agaggggagcagcagcaacctcccccacccccgcctcctcctgggcccctccggccgctc
gcgggcccttctcggaagagctccctcaaagtccgcctcagtcgcctcttccgcacgaag
agctgcaacggtggctccggcggtggggatggggccggcaagaggccttccggagagctg
ggtgcttcggctgcgagcctgacagacgtgggaggctttgcgggccgggagctggacgcg
gggaggaaacccaggttgacaagaactcaaagtgccttttctccagtctccttcagcccc
ctgttcacaggtgaaacagtgtcacttgtggacgtggacatctctcagcggggcctgacc
tctccacaccctccaactccccctcctcctccaagaagaagcctcagcctcctagatgat
atcagtgggacgctgcctacatctgtccttgtggctccgatggggtcttccctgcagtct
ttccccctacctccgcctcctccacctcatgccccagatgcgtttccccggattgctccc
ctccgagcagccgaatccctgcacagccaacccccgccacccctccagtgtcccctctac
cggcccgactcaagcagctttgcagccagccttcgagagctggagaagtgtggttggtat
tgggggccgatgaattgggaagatgcagagatgaagctgaaaggcaagcctgatggttct
ttcctggtacgagacagctctgatcctcgttatatcctgagcctcagtttccgatcacag
ggtatcacccatcacaccagaatggagcactacagaggaaccttcagcctgtggtgtcat
cccaagtttgaggatcgctgtcaatcagtggtggagttcattaagagagccatcatgcac
tccaagaatgggaagtttctctatttcttgagatccagggttccaggactgccaccaact
ccagtccagctgctctatccagtgtcccgattcagcaatgtcaaatccctccagcacctt
tgccgattccgaatccgacagctcgtccggatagatcacatcccggatctcccactgcct
aagcctctgatctcttatatccgaaagttctactactatgatcctcaggaagaggtatac
ctgtctctaaaggaagcgcagctcatttccaaacagaagcaagaggtgttggaaccctcc
acgtag

KEGG   Delphinapterus leucas (beluga whale): 111173136
Entry
111173136         CDS       T05885                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04910  Insulin signaling pathway
dle04917  Prolactin signaling pathway
dle04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111173136 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111173136 (SOCS4)
   04917 Prolactin signaling pathway
    111173136 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111173136 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111173136 (SOCS4)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111173136 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 111173136
NCBI-ProteinID: XP_022426225
UniProt: A0A2Y9MWJ5
LinkDB
Position
Unknown
AA seq 440 aa
MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVSAIEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLSQTELRDGQLKQRR
NMEEVNCFSHTSVQPCVITNNDSSGRGGPGTGSIMNLASNNSIEDSDMDSDDEIITLCTS
SRKRNKPKWEIDEETLQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFPLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQRC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaatagtgaaagtaatagtaaaaatgtagatgtaaggcccaaaactagtcgg
agtcgaagtgctgacagaaaggatggttatgtatggagtggaaagaagttatcttggtca
aaaaagagtgaaagttgttcagatgctgaaacagtgagtgctatagagaaaactgaagtt
cctttaaggagccaagaaaggaagcacagctgttcatctatcgagttggatttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaactgcaagatgctgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccgtctaaaaga
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataagtcccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcaactaaaacaacgaaga
aacatggaagaggtcaactgcttctcacataccagtgttcagccctgtgtcataaccaat
aacgattcttcgggtagaggtggtcctgggactggctctataatgaacctggcttcaaat
aacagtatagaagatagtgatatggattcagatgatgaaattataacactttgcacaagt
tccaggaaaagaaacaaacccaaatgggaaattgatgaagaaaccctgcaactggaaaca
cctcctaagtaccatacccagattgattatgtccactgtcttgtaccagacctccttcag
atcaataataatccatgttactggggcgttatggataaatatgcagctgaagctctacta
gaaggaaaaccagagggtacctttttactgcgagattcagcacaggaagactatttattc
tccgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgatccttgtgtcttccattctcctgacataactgggctc
ctagagcattataaggacccgagtgcctgtatgttctttgaaccacttttatccactcct
ttaattcggactttcccctttcccctgcagcatatatgcagaacagttatttgtaactgt
acaacttatgatggcattgatgcccttccaattccttcttccatgaaattatatctgaaa
gaatatcactataaatcaaaagttagagtactcaggattgatgcaccagaacagcgatgc
tag

KEGG   Delphinapterus leucas (beluga whale): 111174797
Entry
111174797         CDS       T05885                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111174797 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111174797 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111174797 (SOCS5)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111174797 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 111174797
NCBI-ProteinID: XP_022429621
UniProt: A0A2Y9N4J7
LinkDB
Position
Unknown
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFSHEGGSRSENVDMNSNRCLSVKDKNISIGDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNRNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRAVGSRSLRQR
LQDTVGLCFPMRTYNKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEINGDNSAIPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaaatacaggtgtcagaatctcttcagt
catgagggaggaagccgtagtgaaaatgtggatatgaactccaacagatgtttgtctgtc
aaagacaaaaacatcagtataggagactcagctcctcagcaacaaagcagtcccttaaga
gaaaatgttgccttacaactggggttaagcccttcaaagaattcttcaaggagaaaccga
aactgtgccactgaaattcctcagattgttgaaataagcattgaaaaggataatgactca
tgtgtcaccccaggaacaagacttgcaagaagagattcctactctcgacatgctccttgg
ggtgggaagaagaaacattcctgttctacaaagacacagagttcactagataccgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgatatggtgtaagctct
gtgcacgacatggacagcgtttccagcagagccgtaggaagtcgctctctgagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacaacaagcagtcaaagccc
ctcttttctaataaaagaaaaatacacctttctgagttaatgcttgagaaatgccctttt
cctgctggctcggatttggcccaaaaatggcatttgattaaacagcatacagcccctgtg
agcccacattcaacattttttgatacatttgatccatccttggtttctacagaagatgaa
gaagataggcttcgagagagaaggaggcttagtattgaagaaggggttgacccccctccc
aacgcacaaatacatacgtttgaagccactgcacaggttaacccgttatataaactggga
ccaaagttagctcctggaatgactgaaataaatggggacaattctgcaattccacaagct
aattgtgactctgaagaggacacaaccacgctgtgtttgcagtcacggaggcagaagcaa
cgtcaggtatctggagacagccatgcccacgttagcagacagggagcttggaaagtccat
acacagattgattacatacactgcctcgtgcccgatttgcttcagatcacaggtaatccc
tgttactggggagtgatggaccgttacgaagcagaagcccttctggaagggaaacctgaa
ggtacatttttgctcagggactctgcacaggaggactacctcttctctgtgagcttccgt
cgctacaacagatccctgcatgcccgaattgaacagtggaatcacaactttagttttgat
gctcacgacccgtgtgtgtttcactcctccactgtaacaggacttttggaacattacaaa
gaccccagttcttgcatgttttttgaaccgctgcttacgatatcactaaataggaccttc
ccttttagcctgcagtacatctgccgtgcagtcatctgcaggtgcactacgtatgatgga
attgatgggctccctttaccgtcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggctagaacgagaaccagtcaaggcaaagtaa

KEGG   Delphinapterus leucas (beluga whale): 111180175
Entry
111180175         CDS       T05885                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111180175 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111180175 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111180175 (SOCS6)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111180175 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111180175
NCBI-ProteinID: XP_022439986
UniProt: A0A2Y9PBZ1
LinkDB
Position
Unknown
AA seq 535 aa
MKKISLKTFRKSFNLNKSKEEADFMVVQQPSLASDFGKEDSLFGSCYGKDIASCDLNSED
EKGGKSRSKSESLMGTLKRRLSAKQKPKGKGGVPSGGSADEDTFSSSSAPIVFKDVRAQR
PMRSTSLRSHHYSPTPWPLRPTASEETCIKMEVRVKALVHSPGPGPALNGVRKDFHDLQA
DTACQEQTNSLKSSESQDGDLHLHLEEHVPVVIGLVPQDYIQYTVPLEEGMYPLEGPRGY
CLDGSSPMEVSAVPPPVGGGSFPEDENQVDPDLVVAPEIFVDQSVNGLLIGTTGVVLQSP
RASPDDAPPLSPLLPPLQTNQIQRNFGGLASSDAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSVRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaagattagtcttaaaaccttccggaaatctttcaacttgaataaaagtaaagaa
gaagcggattttatggttgtacaacaaccatcactagccagtgactttggaaaagaggat
tccttatttggtagctgctatgggaaagatatagccagctgtgatctcaacagtgaagat
gaaaaaggcggaaagagtagatcaaaaagtgaaagcctaatgggtacgttgaaaagacgg
ctgtctgcgaaacagaagccgaagggcaagggcggcgtgccctccgggggctccgcggac
gaggacaccttctcctcctcctcagcccccatcgtcttcaaggacgtgagggcgcagagg
cccatgaggtccacctcgctgcgcagccaccactacagccccacgccgtggcccctgcgc
cccaccgcgtcggaggagacgtgcatcaagatggaggtgagggtcaaggccctggtccac
tcgcccggcccgggcccggccctgaacggcgtgcgcaaggacttccacgacctccaggcc
gacaccgcgtgccaagaacagacgaactcgctcaagagttctgagtctcaggatggggac
ctgcatctccacctggaagaacatgtgcctgtcgttatcggactcgtgcctcaggactac
attcagtacactgtgcctttggaggaggggatgtaccctctggaaggaccgcgcggctat
tgtctggacggctcctcccccatggaagtctccgcggtccctcctccagtgggagggggc
tccttccccgaagacgagaatcaggtagacccggacctcgtggtggccccagagatcttc
gtggaccagtcggtgaatggcttgctgatcggcaccacgggagtcgtgctgcagagccca
agggcgagtcccgacgacgccccgccactctcaccgttgctacctcccctgcagacgaat
cagatccaaaggaacttcggcgggctcgccagctccgacgcccacgtggccgaaagtatg
cgctgtcacttgaatttcgatcctaactctgcccccggggttgccagagtttatgactcg
gtgcagagtagtggtcccatggtcgtgacaagccttacggaggagctgaagaaacttgcg
aaacagggatggtactggggccccatcactcgctgggaggcagaagggaagctggccaac
gtgccggatggctctttcctcgttcgggacagttctgacgaccgctaccttttaagcttg
agcttccgctcgcatggcaagacccttcacactagaatcgaacattcaaatggtaggttt
agcttttatgaacagccggacgtggaaggacacacgtctatcgtggacctgatcgagcac
tcagtcagggactccgagaacggggccttctgttactccaggtctcgcctgccgggctcg
gccacctaccccgtcaggctgaccaaccccgtgtcccgcttcatgcaggtgcgctccctg
cagtacctgtgccggttcgtcatccgtcagtacaccagaatagacctgattcagaagctg
cctctgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Delphinapterus leucas (beluga whale): 111182757
Entry
111182757         CDS       T05885                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04380  Osteoclast differentiation
dle04630  JAK-STAT signaling pathway
dle04668  TNF signaling pathway
dle04910  Insulin signaling pathway
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04935  Growth hormone synthesis, secretion and action
dle05160  Hepatitis C
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111182757 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182757 (SOCS3)
   04668 TNF signaling pathway
    111182757 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111182757 (SOCS3)
   04920 Adipocytokine signaling pathway
    111182757 (SOCS3)
   04917 Prolactin signaling pathway
    111182757 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    111182757 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111182757 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111182757 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    111182757 (SOCS3)
   04931 Insulin resistance
    111182757 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111182757 (SOCS3)
   05164 Influenza A
    111182757 (SOCS3)
   05168 Herpes simplex virus 1 infection
    111182757 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111182757 (SOCS3)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111182757 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box Exostosin
Other DBs
NCBI-GeneID: 111182757
NCBI-ProteinID: XP_022445166
UniProt: A0A2Y9PIR4
LinkDB
Position
Unknown
AA seq 237 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPSGAPSSSSPPAEPSSSPPAEPSSSPSSEVPEQPSAQPLPGSPPRRAYYIY
SGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgccgtgacgggcggcgaggcgaacctactgctc
agcgccgagcccgccggcaccttcctcatacgcgacagctcggatcagcgccacttcttc
acgctcagcgtcaagacgcagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctcgctgcagagcgatcctcggagcacgcagccagtgccccgcttcgactgcgtg
ctcaagctggtgcatcactacatgccgccctccggcgccccctcctcctcctcgccccca
gctgaaccctcctcctcgccccccgctgaaccctcctcctcgccctcctccgaggtgccc
gagcagccgtcggcccagccgctcccggggagcccccccaggagagcctattacatctac
tcggggggcgagaagatccctctggtgttgagccggcccctctcctccaacgtggccact
ctccaacatctgtgtcggaagaccgttaacggccacctggactcctatgagaaagtcacc
cagctgcctgggcccattcgggagttcctggaccagtacgatgcccccctttag

DBGET integrated database retrieval system