KEGG   Delphinapterus leucas (beluga whale): 111163585
Entry
111163585         CDS       T05885                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04640  Hematopoietic cell lineage
dle04916  Melanogenesis
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111163585 (KITLG)
   04014 Ras signaling pathway
    111163585 (KITLG)
   04015 Rap1 signaling pathway
    111163585 (KITLG)
   04072 Phospholipase D signaling pathway
    111163585 (KITLG)
   04151 PI3K-Akt signaling pathway
    111163585 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111163585 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    111163585 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163585 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111163585 (KITLG)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111163585 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 111163585
NCBI-ProteinID: XP_022408116
UniProt: A0A2Y9LH90
LinkDB
Position
Unknown
AA seq 295 aa
MKKTQTWIITCIYLQLLLFNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRLFTPEKFFGIFNKSIDAFKDLKMVASKTSECVMSSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIEDSNLQWAAVALPAFFSLIIGFAVGALYWKK
KQPNLTRAVENIQINEEDNEIRYFVLLNVCISKLDLATSHTVHVLITSLRSVSLS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacctaggctgtttactcctgaaaaattc
tttggaatttttaataaatccatcgatgccttcaaggacttgaagatggtggcttctaaa
actagtgaatgtgtgatgtcttcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagc
agtaataggaaggcctcaaatcccattgaagactccaacctacaatgggcagccgtagca
ttgccagcattcttttctcttataattgggtttgctgttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataaggtattttgttttactaaatgtgtgcataagtaagcttgaccttgccacttcacat
accgtgcatgtgctcataacctctttaagaagtgtttcactctcatga

DBGET integrated database retrieval system