KEGG   Delphinapterus leucas (beluga whale): 111163760
Entry
111163760         CDS       T05885                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04066  HIF-1 signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04350  TGF-beta signaling pathway
dle04371  Apelin signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04714  Thermogenesis
dle04910  Insulin signaling pathway
dle04931  Insulin resistance
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111163760 (RPS6KB1)
   04350 TGF-beta signaling pathway
    111163760 (RPS6KB1)
   04371 Apelin signaling pathway
    111163760 (RPS6KB1)
   04066 HIF-1 signaling pathway
    111163760 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    111163760 (RPS6KB1)
   04152 AMPK signaling pathway
    111163760 (RPS6KB1)
   04150 mTOR signaling pathway
    111163760 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111163760 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    111163760 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111163760 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    111163760 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    111163760 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    111163760 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163760 (RPS6KB1)
   05205 Proteoglycans in cancer
    111163760 (RPS6KB1)
   05231 Choline metabolism in cancer
    111163760 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111163760 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111163760 (RPS6KB1)
   05212 Pancreatic cancer
    111163760 (RPS6KB1)
   05225 Hepatocellular carcinoma
    111163760 (RPS6KB1)
   05226 Gastric cancer
    111163760 (RPS6KB1)
   05221 Acute myeloid leukemia
    111163760 (RPS6KB1)
   05224 Breast cancer
    111163760 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111163760 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111163760 (RPS6KB1)
   05163 Human cytomegalovirus infection
    111163760 (RPS6KB1)
   05165 Human papillomavirus infection
    111163760 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111163760 (RPS6KB1)
   01522 Endocrine resistance
    111163760 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111163760 (RPS6KB1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111163760 (RPS6KB1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   111163760 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 111163760
NCBI-ProteinID: XP_022408446
UniProt: A0A2Y9LI66
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQAPVEYPMETSG
IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagtcgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagattttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtctggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctggctcggaaggtagagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccggtcacctcgaagatttattggc
agcccacgaacacctgtcagccctgtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcaggcgcctgtggagtacccaatggaaacaagtgga
atagagcagatggatgtgacgacgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagaacac
ctgcgtatgaatctatga

KEGG   Delphinapterus leucas (beluga whale): 111183673
Entry
111183673         CDS       T05885                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04066  HIF-1 signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04350  TGF-beta signaling pathway
dle04371  Apelin signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04714  Thermogenesis
dle04910  Insulin signaling pathway
dle04931  Insulin resistance
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111183673 (RPS6KB2)
   04350 TGF-beta signaling pathway
    111183673 (RPS6KB2)
   04371 Apelin signaling pathway
    111183673 (RPS6KB2)
   04066 HIF-1 signaling pathway
    111183673 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    111183673 (RPS6KB2)
   04152 AMPK signaling pathway
    111183673 (RPS6KB2)
   04150 mTOR signaling pathway
    111183673 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111183673 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    111183673 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111183673 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    111183673 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    111183673 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    111183673 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183673 (RPS6KB2)
   05205 Proteoglycans in cancer
    111183673 (RPS6KB2)
   05231 Choline metabolism in cancer
    111183673 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111183673 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111183673 (RPS6KB2)
   05212 Pancreatic cancer
    111183673 (RPS6KB2)
   05225 Hepatocellular carcinoma
    111183673 (RPS6KB2)
   05226 Gastric cancer
    111183673 (RPS6KB2)
   05221 Acute myeloid leukemia
    111183673 (RPS6KB2)
   05224 Breast cancer
    111183673 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111183673 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111183673 (RPS6KB2)
   05163 Human cytomegalovirus infection
    111183673 (RPS6KB2)
   05165 Human papillomavirus infection
    111183673 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111183673 (RPS6KB2)
   01522 Endocrine resistance
    111183673 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111183673 (RPS6KB2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111183673 (RPS6KB2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   111183673 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 111183673
NCBI-ProteinID: XP_022446984
UniProt: A0A2Y9PJ68
LinkDB
Position
Unknown
AA seq 544 aa
MAAVFDLDLETEEGSEGEGEPEFSPAAPSPSPASPFPALASPPQSWPIACQLPFVTLPTP
GPSSPAWGEGAWHLPWLLPLGFSQDVCPLAELRAAGLEPVGHYEEVELTESSVNPGPERI
GPHCFELLRVLGKGNYGKVFQVRKVQGTNVGRIYAMKVLRKAKIVRNAKDTAHTRAERNI
LESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTRLEREGIFLEDTACFYLSEITLAL
GHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILV
RSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLELPAYLTPDARDLVKK
FLKRNPSQRIGGGPGDAADVQRHPFFRHVNWDDLLARRVDPPFRPSLQSEEDVSQFDSHF
TRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSLQPKLRSPRRLNGSPWTPI
SPLKFSPFEGFRPSPGPPEPLEPPLPHLLLLPPPLPPPSSTAPLPIRPPSGTKKSKKGRG
RPGR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagacggaggaaggcagcgagggcgagggcgag
ccagagttcagccccgcggcccccagcccttcccctgcgtctccctttcctgccctcgcc
tctcctccgcagtcctggcccatcgcctgccagctcccattcgtcacccttcccacgcct
gggccaagcagtccagcttggggggagggagcctggcacctcccttggctcttacccctc
ggtttctcacaggacgtgtgtccccttgccgagttgagggcggctggcctggagcctgtg
ggacactatgaagaggtggagctgactgagagcagtgtgaacccaggccctgagcgcatc
gggccccactgcttcgagctgctgcgcgtgctgggcaaggggaactatggcaaggtgttc
caggtgcgaaaggtgcagggcaccaatgtgggcagaatatatgccatgaaagtcctgagg
aaggccaaaattgtgcgcaatgccaaggacacggcacacacgcgggctgagcggaacatt
ctagagtcagtgaagcaccccttcattgtggaactggcctatgccttccagactggtggc
aaactgtacctcatcctggagtgcctcagtggcggcgagctcttcacacgtctggagcga
gagggcatcttcctggaagacacggcctgtttctacctgtcagagatcacactggccctg
ggccatctccactcccaaggcatcatctaccgggatctcaaacctgagaacatcatgctc
aacagccagggtcacatcaaactgacggacttcggcctctgcaaggagtcgattcacgag
ggtgccgtcacccacactttctgcggcaccatcgagtacatggcccctgagattctggtg
cgcagtggccacaaccgggcggtggactggtggagcttgggggccctgatgtacgacatg
ctcactggatcgccacccttcactgcagagaaccggaagaaaaccatggataagatcatc
agagggaagctggagctgcccgcctacctcaccccagatgcccgggacctcgtcaaaaag
tttctgaagcggaatcccagccaacgtatcgggggtggccccggggacgccgctgatgtg
cagaggcaccccttcttccggcacgttaattgggatgacctcctggcccgccgagtggac
ccccctttccggccgtccctgcagtcggaggaggacgtgagccagtttgactcccacttc
acgaggcagacgccggtggacagtccagacgacacggccctcagtgagagtgccaaccag
gccttcctgggcttcacgtacgtggcgccctcggtcctggacagcatcaaggagggcttc
tccctccagcccaagctgcgctcccccaggcgcctcaacggcagcccctggacccccatc
agccccctgaagttctcaccctttgagggattccggcccagccccggcccaccggagccc
ctggagccccctctaccccatctcttgctgctgccgccgccactaccgccgccctcgagc
actgcccccctccccatccgacccccttcagggaccaagaagtccaagaaaggccgtggg
cgccccgggcgctaa

DBGET integrated database retrieval system