KEGG   Delphinapterus leucas (beluga whale): 111163780
Entry
111163780         CDS       T05885                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1 isoform X1
  KO
K05130  interferon receptor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111163780 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    111163780 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111163780 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111163780 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111163780 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    111163780 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    111163780 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111163780 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163780 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111163780 (IFNAR1)
   05160 Hepatitis C
    111163780 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    111163780 (IFNAR1)
   05164 Influenza A
    111163780 (IFNAR1)
   05162 Measles
    111163780 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    111163780 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163780 (IFNAR1)
   05169 Epstein-Barr virus infection
    111163780 (IFNAR1)
   05165 Human papillomavirus infection
    111163780 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111163780 (IFNAR1)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IFN receptor family
   111163780 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF4542
Other DBs
NCBI-GeneID: 111163780
NCBI-ProteinID: XP_022408505
UniProt: A0A2Y9LG18
LinkDB
Position
Unknown
AA seq 561 aa
MLALLGATTLMLVAGAPWVLPAASGGTNLKSPENGRVCIIDDNFILQWNSSRESVRNVTF
SAEYKIPGMENWKKLPGCQHITSTECNFSSVKLKNVYEKIELRIRAEKGNNTSQWHEVKP
FIPFQEAQIGPLDVHLEAEDKAIIINISPPGTKDSVMWAMDHSSFIYSLVIWKNSSSLEE
RTETVYSRDKIYKLSPETTYCLKVKAELRSPRRVGFYSPVYCINTTEKHKVPSPENIQID
AENQVYVLKWDYAHENTTFRAQWSHEFLKRIPGSHSDKWKQIPNCEDVETTHCVIPQNAF
PEGIHRIRVQASVGNNTSFWSEEKIFNTEMKTIIFPPVISMKSVNDDSLHVSIGAPKESE
NKSVNQLYPLIYEVIFWENTSNAERKVVEKRTDVTFPNLKPLTVYCVKAKALTENGKWNK
SSVFSATVCEKTKPGNTSKTWLIAGICTALFSIIVIIYVVKVLLRCINYVFFPSSKPPST
VDEYFSEQPVRNLLLSTSEEQTERCSIIENANTITVIEETNPIEDHKKYNSQTSQDSGNY
SNEDENSGSKISEELLEQETV
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgctcgcgctcctgggcgcgacgaccctgatgctggtcgctggggcgccgtgggtgttg
cccgcagcttcagggggaacaaatctaaaatctcctgaaaatggcagggtctgcatcatt
gatgacaactttatcctgcagtggaacagcagccgtgagtctgtcaggaatgtgactttt
tcagcagagtataaaataccaggaatggaaaattggaagaagttgcctgggtgtcagcat
attactagtaccgaatgcaacttttcttcagtcaagcttaaaaatgtttatgaaaaaatt
gaattgcgcataagagcagaaaaaggaaacaacacttctcaatggcatgaggttaagcca
tttataccatttcaagaagctcagattggtcctctagatgtacatttagaagctgaagat
aaggcaataataataaacatctctcctcctgggacaaaagatagtgtcatgtgggctatg
gatcattccagctttatatatagcttagttatctggaaaaactcttcaagtctagaagaa
aggactgaaactgtttattccagagataaaatttataaactctcaccagagactacttat
tgtttaaaagttaaagcagaactacgttcaccaagaagagttggtttctatagtccagtg
tattgtataaacaccacagagaaacacaaagtgccttcaccagaaaatatacaaatcgat
gctgaaaatcaggtctatgtccttaaatgggattacgcacatgaaaacacgacttttcga
gctcagtggtcccatgagtttttaaaaaggattcctgggagtcattcagacaaatggaaa
caaataccaaactgtgaagatgtcgaaactacccactgtgtgattcctcaaaatgctttc
ccagaaggaattcaccgtatccgtgtacaagcatctgttggaaataacacatctttttgg
tctgaagagaaaatatttaatactgaaatgaaaactatcatatttcctccagtcattagc
atgaaatccgttaatgatgactcactgcacgtctctatcggtgctccaaaagagtctgaa
aacaagtctgtgaaccagctttacccactaatttatgaagttattttttgggaaaacact
tcaaacgctgagagaaaagttgtagagaaaagaactgatgttacctttcctaacttgaaa
ccgctgactgtatactgtgtgaaagccaaagcactcactgagaatggcaagtggaataaa
agcagtgtttttagtgctactgtgtgtgagaaaacaaaaccaggaaatacttccaaaacc
tggcttatagctggaatttgcactgcgttattttctatcattgttatcatttatgttgtg
aaagtcctcttgagatgtatcaattatgtgttctttccatcaagtaaacctccttccact
gtagatgagtatttctctgaacagccagtaaggaatctactcctttccacttctgaggaa
caaacggaaagatgttctataattgaaaatgcaaacactattactgtaatagaagagact
aatccaattgaagatcacaaaaagtacaattcccaaactagtcaagattcaggaaactat
tctaatgaagacgaaaacagtggaagtaaaataagtgaagaacttctggaacaggaaact
gtgtga

DBGET integrated database retrieval system