KEGG   Delphinapterus leucas (beluga whale): 111163990
Entry
111163990         CDS       T05885                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04020  Calcium signaling pathway
dle05200  Pathways in cancer
dle05216  Thyroid cancer
dle05223  Non-small cell lung cancer
dle05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111163990 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163990 (RET)
   05230 Central carbon metabolism in cancer
    111163990 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    111163990 (RET)
   05223 Non-small cell lung cancer
    111163990 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111163990 (RET)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111163990 (RET)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  RET family
   111163990 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 111163990
NCBI-ProteinID: XP_022408951
UniProt: A0A2Y9LJM0
LinkDB
Position
Unknown
AA seq 1113 aa
MEKATAGTVGLRLLLLLPLLGEAPLGLYFSRDAYWERLYVDQPAGMPLLYVHALQDVPEE
VPSFRLGQHLYGAYRTRLHENDWVRIQEDTGLLYLNRSLDHSSWEKLSIRNGGFPLLTVY
LQVFLSPTSLREGECQWPGCARVYFSIINASFPACGALKPRDLCFPEMGLSFRIRENRPP
GTFHQFRLLPVQFLCPNVSAAYRLLGGESLPFRCAVDSLEVSTRWALDREKREKYELVAT
CTVRVGTREEEVMVPFPVTVYDEDDSAPSFLGGVDTASAVVEFKRKEGTVVATLRVFDAD
VVPASGELLRRYTSTLLSGDAWALQTFRVEHSPNETLAQANGSFVRATVHDYRLVLNRSL
PISESRAVQLAVLVNDSDFQGPGEGVILLHFNVSVLPVSLRLPSTYSFAASRRARRFAQI
GKVCVENCQEFSGIHVQYRLQLSSANCSALGVVTSAEDTTGTLFVNDTEALQRPECAQLQ
YTVVAVERPTRRQAQAPLLVTLEGTYVAEEPGCPLSCAVSKRRPECEECGGLGSLTGRCE
WRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESRDANICPQDCLRGGSIIGGHEPGERRG
IKAGFGICNCFPEEKKCFCEPEDSQDPLCDGLCRTVITAAVLFSFIVSVLLSTFCIHRYH
KNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSVENQVSVDTFKIPEDPKWEFPR
KNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASASELRDLLSEFNLLTQ
VSHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGYVGSRDSRNSSYLDNP
EERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRRMKISDFGLSRDVYE
EDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLF
NLLKTGYRMERPDNCSEEMYSLMLQCWKEEPDKRPVFADISKDLDKMMVKSRDYLDLAAS
TPSDSLLYDDGLSEEEMPLVDCNNAPLPRTLPSTWIENKLYGMSDPNWPEESPVPLTRAD
GTNTGCPRYANDSVYANWMVSPSAAQLMDTFDS
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggagaaggcgacggccggcaccgtggggctgcggttgctgctgctgctgccgctgctc
ggcgaagccccactgggactctacttctcaagggatgcttactgggagaggctgtacgtg
gaccagccggccggcatgcccctgctctacgtccacgccctgcaggacgtccccgaggag
gtgcccagcttccgcctgggccagcacctctacggcgcctaccgcacacggctgcacgag
aacgactgggtccgtatccaggaggacacggggcttctctaccttaaccggagcctggac
cacagctcctgggagaagcttagcatccgcaacggtggcttcccgctgctcaccgtctac
ctccaggtcttcctgtcgcccacgtcccttcgtgagggcgagtgccagtggccaggctgt
gcccgagtgtacttctccatcatcaacgcctccttcccggcttgcggtgccctcaaaccc
cgggacctctgcttccccgagatgggcctgtccttccgcattagggagaacaggcctccc
ggcaccttccaccaattccgcctgctccctgtgcagttcctctgccccaacgtcagcgca
gcctacaggcttctgggaggtgagagtctgcccttccgctgcgctgtggacagcctggag
gtgagcacgcgctgggccctggaccgcgagaagcgggagaagtatgagctggtggctacg
tgcacggtgcgcgtcggcacgcgtgaggaggaggtgatggtgcccttccccgtgaccgtg
tacgacgaagacgactctgcgcccagcttccttgggggcgtcgacaccgccagcgccgtg
gtggagttcaagcggaaggagggcactgttgtggccacactacgtgtcttcgatgcagat
gtggtgccagcatccggggagctcctgagacggtacacaagcacgctgctctccggggat
gcctgggccctccagaccttccgagtagagcactcgcccaacgagaccttggcccaggcc
aacggcagctttgtgcgggcaaccgtgcatgactacaggctggttctcaaccggagcctc
cccatctcggagagccgggccgtgcagctggccgtgctggtcaacgactcggacttccag
ggcccgggggagggcgtcatcctcctccacttcaacgtgtctgtgctgcccgtcagcctg
cgcctgcccagcacctactcctttgccgcgagcaggcgggcccgccgcttcgcccagatt
gggaaagtctgtgtggaaaactgccaggagttcagtggcatccacgtgcagtacaggctg
cagctctccagcgccaactgcagcgccctgggggtggtcacctcggccgaggacaccacg
gggaccctgttcgtgaacgacacggaggccctgcagcggcccgagtgtgcccaactccag
tacacggtagtggccgtcgaacggccaacccgccggcaagcccaggccccactgctcgtc
acactggaggggacatatgtggcagaggagccaggctgccccctgtcctgcgcggtcagc
aagaggcggcccgagtgtgaggaatgcggcggcctgggctctctgacgggcaggtgcgag
tggagacagggagacggcaaagggatcaccaggaacttctccacctgctcccccagcatc
aagacctgccccgatggccactgtgacgccgtggaaagcagagatgccaacatctgcccc
caggactgcctccggggcggcagcatcattggtgggcacgagcctggggagcgccggggg
attaaagccggcttcggtatctgcaactgcttcccggaggagaagaagtgtttctgtgag
ccggaagacagccaagacccgctgtgtgacgggctttgccgcacagtgatcacggcagcc
gtgctcttctccttcatcgtgtccgtgctgctgtccaccttctgcatccaccgctaccac
aagaatgcccacaagccacccatcgcctcagctgagatgaccttccgccggcctgcccag
gcctttccggtcagctactcctcatccggtgcccgccggccctcgctggactccgtagag
aatcaggtctctgtggacaccttcaagatcccggaggatccaaagtgggaattccctcgg
aagaacttggttcttggaaaaactctgggagaaggagaatttggaaaagtggtcaaagca
acggccttccggctgaaaggcaaagcggggtacacgactgtggctgtaaagatgctgaaa
gagaatgcctcggcgagcgagctgcgggacctgctgtcagagttcaacctcctgacgcag
gtcagccacccgcaagtcatcaagctatatggagcctgcagccaggacgggccgctgctc
ctcattgtggagtatgccaagtacggctccctgcggggctttctccgagagagccgcaag
gcggggcccggctacgtgggcagcagagacagccgcaactccagctacctggacaacccg
gaggagcgggccctgaccatgggcgacctcatctccttcgcctggcagatatcgcggggg
atgcagtacctggccgagatgaagctcgtccatcgggacttggcagccagaaacgtccta
gtagccgaggggcgcaggatgaagatctcggattttggtctgtcccgagatgtttatgaa
gaggattcctacgtgaagaggagcaagggtcggatcccagtcaagtggatggccattgag
tccctcttcgatcacatctacaccacccagagtgacgtgtggtccttcggtgtcctgctg
tgggagattgtgaccctggggggcaacccctaccctgggattcctccagagcggctcttc
aaccttctgaagacaggctaccggatggagaggccagacaactgcagcgaggagatgtac
agtctgatgctgcagtgctggaaggaagagccagacaagaggccagtgttcgctgacatc
agcaaagacctggataagatgatggttaagagcagagactacttggacctggccgcgtcc
accccatctgattccctgctgtatgacgacggcctgtcggaggaggagatgcccctggtg
gactgtaataacgctcccctccctcgaaccctcccctccacgtggattgaaaacaaactc
tatggcatgtcagacccgaactggcctgaagagagtcctgtaccactcacgagagccgat
ggcaccaacactgggtgtccaagatatgcaaatgatagtgtatatgctaactggatggtt
tcaccctccgcggcacaattaatggacacgtttgatagttaa

KEGG   Delphinapterus leucas (beluga whale): 111172744
Entry
111172744         CDS       T05885                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04728  Dopaminergic synapse
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111172744 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    111172744 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111172744 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111172744 (KIF5C)
   05012 Parkinson disease
    111172744 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    111172744 (KIF5C)
   05016 Huntington disease
    111172744 (KIF5C)
   05020 Prion disease
    111172744 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    111172744 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111172744 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111172744 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111172744 (KIF5C)
   04147 Exosome [BR:dle04147]
    111172744 (KIF5C)
Membrane trafficking [BR:dle04131]
 Others
  Actin-binding proteins
   Others
    111172744 (KIF5C)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     111172744 (KIF5C)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111172744 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 111172744
NCBI-ProteinID: XP_022425397
UniProt: A0A2Y9N1Y1
LinkDB
Position
Unknown
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPTTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVL
QHLEMELNRWRNGEAVPEDEQISAKDQKSLEPCDNTPIIDNIVPVVAGISAEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTARVKKSVELDSDEGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgagtgcagcatcaaagtgatgtgccggttccggccactcaacgaa
gctgagatcctccgcggggacaaattcatccccaaatttaaaggcgatgagaccgtggtg
atcgggcaaggaaagccatatgtcttcgacagagtgctgcctcccaccacgacccaagag
caggtttacaacgcgtgtgcaaagcaaattgtcaaagatgtccttgagggttataatggg
acaatttttgcgtatggacagacatcatcagggaaaacgcacaccatggaggggaagcta
cacgaccctcaactcatgggcatcatcccaaggatcgcacacgacatctttgaccacatc
tattccatggacgagaacctggagttccacatcaaggtttcctattttgaaatctacctg
gacaaaatcagggacttactcgatgtatccaagacaaacttggctgttcatgaagataaa
aacagagtcccgtacgtaaaggggtgcaccgagcggtttgtgtcaagccccgaggaggtc
atggacgtgatagatgaaggcaaagcaaaccgccacgtggctgtaacgaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtgggaagctttatctagttgatttggctgggagcgaaaaggtcagc
aaaactggtgccgagggagctgttctcgacgaagctaaaaatatcaataagtctttgtct
gctcttggaaacgtgatctctgccttggcagaagggacaaaaacacacgtgccataccgg
gacagcaagatgactcggattcttcaggactctctgggcgggaactgtagaaccaccatc
gttatttgctgttctccctcggtattcaatgaagctgagaccaagtcaacgctaatgttt
ggacaaagggctaagaccatcaagaatacagtctctgtgaacctggagctgacagcggaa
gaatggaagaagaaatatgaaaaagagaaagagaaaaacaagactttgaagaatgttctc
cagcatctggagatggagctaaacaggtggagaaatggagaagctgtgcctgaggatgaa
cagatcagtgctaaggaccagaagtccctggagccctgtgataacacccccatcatagac
aacattgttcctgtggttgctggcatctctgcagaggagaaggagaagtatgatgaggag
atctccagtctctaccgacaactggatgataaggatgatgaaattaaccagcagagccag
ctggctgaaaagctaaagcaacagatgttggatcaggatgagcttttagcttctacaaga
agagactatgagaagattcaggaggagctgacacgtctccagattgaaaatgaggcagcc
aaagatgaggtgaaagaagttctccaggccttggaggagctggctgtcaattacgaccag
aagtcacaggaagtggaggacaagaccagggccaatgagcagctgacagatgagctggcc
cagaaaacgactacattgacaaccacacagagagagctgagccagctgcaagagcttagc
aatcaccagaaaaagagggctaccgagatcctgaatttgctgctgaaggatctgggggag
ataggaggaattattggcaccaatgatgtgaagactttggcagatgtgaatggagtcatt
gaggaggagttcaccatggcccggctgtacatcagcaagatgaagtcggaggttaaatct
ctggtgaaccgcagtaaacagctcgagagcgcccagatggactccaacaggaagatgaac
gccagtgagcgggagctggcggcctgccagctgctcatctcccagcatgaagccaagatc
aaatccctgacagactacatgcagaacatggagcagaagaggaggcagctggaagagtcc
caagactcgctcagtgaagagctggccaagctccgagcccaagaaaaaatgcatgaagtc
agcttccaggataaagaaaaggaacatctgacccggctgcaggacgctgaggaaatgaag
aaggcgctggagcagcagatggagagccaccgggaagctcatcagaagcagctgtccaga
ctccgagacgaaatcgaggagaagcagaaaatcatcgatgagattcgggatttgaatcag
aaactgcaactggaacaggagaagctcagctctgattataacaagctgaaaatagaggac
caagagagagaaatgaaactggaaaagctcttattgctcaatgataaaagagaacaagcc
agagaggacctcaaagggctggaggagacagtgtctcgagagctacagactctgcacaac
ctccgtaaactcttcgtccaggatctgaccgcccgggttaaaaaaagtgtagagctggac
agcgacgagggaggaggcagtgctgcccagaagcagaaaatttccttcctggagaataac
ctggagcagctcactaaggtccacaaacagctggtccgggacaacgcagacctgcgctgt
gagctgcccaagctggagaagcgcctgcgtgccacggccgagcgcgtcaaggcactggag
agcgcactgaaggaggccaaggagaacgccatgcgggaccgcaagcgctaccagcaggag
gtggaccgcatcaaggaggctgtgcgagccaagaacatggccaggagggcccactcggcc
cagatcgccaagcccatccgccctggacactacccagcatcgtctccaacggccgtccac
gccatccgagggggaggaggcagctcttcaaactccactcactaccagaaataa

KEGG   Delphinapterus leucas (beluga whale): 111173834
Entry
111173834         CDS       T05885                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin heavy chain isoform X2
  KO
K10396  kinesin family member 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04728  Dopaminergic synapse
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111173834 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    111173834 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111173834 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111173834 (KIF5A)
   05012 Parkinson disease
    111173834 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    111173834 (KIF5A)
   05016 Huntington disease
    111173834 (KIF5A)
   05020 Prion disease
    111173834 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    111173834 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111173834 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111173834 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111173834 (KIF5A)
   04147 Exosome [BR:dle04147]
    111173834 (KIF5A)
Membrane trafficking [BR:dle04131]
 Others
  Actin-binding proteins
   Others
    111173834 (KIF5A)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     111173834 (KIF5A)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111173834 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Other DBs
NCBI-GeneID: 111173834
NCBI-ProteinID: XP_022427434
UniProt: A0A2Y9MY94
LinkDB
Position
Unknown
AA seq 965 aa
MQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAQDIFNHIYSMDENL
EFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEG
KSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGA
VLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPS
NYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLETEL
SRWRSGEDVPETERLAGEDAALGAELCEETPVNDNSSIVVRIAPEERQKYEEEIRRLYKQ
LDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQQELSHLQSENDAAKDEVKEV
LQALEELAMNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVSGHQRKRI
AEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKSVVKRCRQ
LENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEESYDSLSDE
LAKLQAQETVHEVALKDKEPDTQDSEDVKKALELQMDSHREAHHRQLARLRDEINEKQKT
IDELKDLNQKLQLELEKLQADYEKLKNEEHEKSTKLQELTFLYERHEQSKQDLKGLEETV
ARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQL
VRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYK
SSGKRGHSAQIAKPVRPGHYPASSPTNAYGTRSPECISYTNSLFQNYQNLYLQAAPSSTS
DMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ
ETAAS
NT seq 2898 nt   +upstreamnt  +downstreamnt
atgcagattgtcaaagatgtccttgctggctacaatggcaccatttttgcttatggacag
acatcctcagggaagacacatactatggagggaaagctgcatgaccctcagctgatggga
atcattcctcgaattgcccaagacatcttcaaccatatctactccatggatgagaacctt
gagttccacatcaaggtttcctactttgagatttacctggacaaaatccgtgaccttctg
gatgtgaccaagacaaatctgtctgtgcacgaggacaagaaccgagtgccgtttgtcaag
ggttgtactgagcgctttgtgtccagcccagaagaaattttagatgtgattgatgaaggg
aaatcaaatcgtcatgtggctgtcaccaacatgaatgaacacagctctcgaagccatagc
atcttcctcatcaacatcaagcaggagaacatggagaccgagcagaagctcagtgggaag
ctgtatctagtggacctggcagggagcgagaaggtcagcaagactggagcagagggagct
gtgctggacgaggccaagaatatcaacaagtccctgtcagccctggggaacgtgatctct
gcgctggctgagggcacaaaaagctacgttccatatcgtgacagcaaaatgacacggatt
ctccaggactccttgggaggaaactgccggacaaccatgttcatctgctgctcaccgtcc
aactacaatgatgcggagaccaagtccaccctgatgttcggacagcgggcaaagaccatt
aagaacactgcctccgtgaatctggagttgactgccgagcagtggaagaagaaatatgag
aaggagaaggagaagacaaaggctcagaaggagacgattgcaaagctggagacagagctg
agccggtggcgcagtggagaggacgtgccagagacggagcgcctggctggggaggatgct
gccctgggagctgagctctgtgaggaaacgcccgtgaacgacaactcatccatcgtggtg
cgcatcgcgcctgaggagcggcagaagtacgaggaggagatccgccgcctctacaagcag
cttgatgacaaggatgatgagatcaaccagcagagccaactcatagagaagctcaagcag
cagatgctggaccaggaagagctgctggtgtccactcgaggagacaatgagaaggtccag
caggagctgagccacctgcagtcggagaacgacgccgcgaaggatgaggtgaaggaagtg
ctgcaggcactggaggagctggccatgaactacgaccagaagtcccaggaggtggaggag
aagagccagcagaaccagcttctggtggatgagctgtctcagaaggtggccaccatgctg
tccctggagtctgagttgcagcggctacaggaggtcagtggacaccagcgaaaacgaatt
gctgaggtgctgaacgggctgatgaaggacctgagtgagttcagtgtcatcgtgggcaac
ggggagattaagctgccggtggagatcagcggggccatcgaggaggagttcactgtggcc
cgactctacatcagcaaaatcaaatccgaagtcaagtctgtggttaaacggtgccggcag
ctggagaacctccaggtcgaatgtcaccgcaagatggaagtgactgggcgggagctctca
tcctgccagcttctcatctcccagcatgaggccaagatccgctccctgacggaatacatg
cagagcgtggagctcaagaagcggcacctggaagagtcctatgactccctgagtgatgag
ctggccaagctccaagcccaggaaactgtgcatgaagtagccctgaaggataaggagcca
gacacacaggactcagaagatgtgaagaaggccctggagctgcagatggacagccaccgg
gaggcccatcaccggcagctggcccggctccgggacgagatcaatgagaagcagaagacc
attgatgagctcaaagacctgaatcagaagctccagttagagctggagaagcttcaggct
gactatgagaagctgaagaatgaagaacatgagaaaagcaccaaactccaggagctgaca
tttctgtatgagcgacacgagcagtccaagcaggacctcaagggcctggaggagacagtt
gcccgggaactccagaccctccacaaccttcgcaagctgttcgttcaagacgtcacgact
cgagtcaagaaaagtgcagaaatggagcccgaggacagtggggggattcactcccaaaag
cagaagatttcctttcttgagaacaacctggaacagcttacaaaggttcacaaacagctg
gtacgtgacaatgcagatctgcgttgtgagcttcctaagttggaaaaacgacttagggct
acggctgagagagttaaggccctggagggtgcactgaaggaggccaaggagggcgccatg
aaggacaagcgccggtaccagcaggaggtggaccgcatcaaggaggccgttcggtacaag
agctccggcaaacggggccattctgcccagattgccaaacccgtccggcctggccactac
ccagcatcttcacccaccaacgcctatggcacccggagccctgagtgcatcagttacacc
aacagcctcttccagaactaccagaatttgtacctgcaggctgcacctagctccacctca
gacatgtactttgcaaactcctgtaccagcagtggggccacatcttctggaggccccttg
gcttcctaccagaaggccaacatggacaatggaaatgccacagatatcaatgacaatagg
agtgacctgccatgcggctacgaggctgaagaccaggccaagctgttccctctccaccaa
gagacggcagccagctaa

KEGG   Delphinapterus leucas (beluga whale): 111178120
Entry
111178120         CDS       T05885                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain
  KO
K10396  kinesin family member 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04728  Dopaminergic synapse
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111178120 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    111178120 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111178120 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111178120 (KIF5B)
   05012 Parkinson disease
    111178120 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    111178120 (KIF5B)
   05016 Huntington disease
    111178120 (KIF5B)
   05020 Prion disease
    111178120 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    111178120 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111178120 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111178120 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111178120 (KIF5B)
   04147 Exosome [BR:dle04147]
    111178120 (KIF5B)
Membrane trafficking [BR:dle04131]
 Others
  Actin-binding proteins
   Others
    111178120 (KIF5B)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     111178120 (KIF5B)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111178120 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin
Other DBs
NCBI-GeneID: 111178120
NCBI-ProteinID: XP_022436339
UniProt: A0A2Y9NMK8
LinkDB
Position
Unknown
AA seq 964 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTIMIASKPYAFDRVFQSNTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEREKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKTNLEAFAVDKDITITNDKPAATIGVTGNFTDSERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSASLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCRQLESTQTESSRKVEENEKELAACQLRISQHEAKIRSLTEYLQNVEQKKRQL
EESVDSLSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMALEQGRLRAEHEKLKATEQDKSRKLRELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPAHPSAVRGGGAPVQNGPPAAVRGGGG
VKSN
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggcggacccggccgagtgcaacatcaaagtgatgtgtcgcttcagaccgctgaacgag
tccgaggtgaaccgcggcgataagtacatcgccaagtttcagggagaagacacgatcatg
atcgcgtccaagccttatgcatttgaccgggtgttccagtcaaacacatctcaagagcaa
gtgtataatgactgtgcaaagaagattgttaaagatgtgcttgaggggtacaatggaacc
atatttgcatatggacaaacctcctccgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatttatttggat
aagataagggacctgttagatgtttcaaagaccaatctttcagttcatgaggataaaaac
cgagttccctatgtaaaggggtgtacagagcgtttcgtatgtagtccagatgaagttatg
gacaccatagatgaaggaaaatccaacagacacgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaatgtaaaacaagagaacacgcaaacggaa
caaaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctggatgaagctaagaacatcaacaagtccctttctgct
cttggaaatgtcatttctgccttggctgagggtagtacatatgtcccatatcgagatagt
aaaatgacaagaatccttcaagattcattaggtgggaactgtagaaccactattgtaatt
tgctgctctccatcctcatacaatgaatctgaaacaaaatctacgctcctgtttggtcag
agggccaaaacaattaagaacacagtttgtgtcaatgtagagttaactgcagaacagtgg
aaaaagaagtatgaaagagaaaaagaaaaaaataagaccctgcggaacaccattcagtgg
cttgaaaatgaactcaaccgatggcgtaatggagagacagtgcctattgatgaacagttt
gacaaagagaaaaccaacttggaagcttttgcagtggataaggatattactattaccaat
gataaaccagcagccacaattggagttactgggaactttactgattctgaaagaaggaag
tgtgaagaagaaattgctaagttgtacaaacaacttgatgacaaggatgaagaaattaat
caacagagccaattggtagagaaactgaagacccaaatgttggatcaggaagagcttctg
gcatctaccagaagggatcaagataatatgcaggctgagctgaatcgtcttcaggcagaa
aatgatgcctctaaagaagaagtaaaggaagttttacaagccttagaggaacttgctgtc
aactatgatcagaagtctcaggaagttgaagacaaaactaaggaatatgaattacttagt
gatgagctgaatcagaaatcggcaagtttagcaagtatagatgctgagcttcagaaactt
aaggaaatgaccaaccaccagaaaaagcgagcagcggagatgatggcatctttactgaaa
gacctggcagaaatagggattgctgtaggaaacaacgacgtaaagcagcctgagggaact
ggcatgatagatgaagagttcactgtcgcaaggctctacattagcaaaatgaagtcagaa
gtgaaaaccatggtgaagcgctgcagacagctagaaagcacacagactgagagcagcaga
aaagtggaagaaaatgagaaggagttggcggcgtgccagcttcgcatctcccagcatgaa
gccaaaatcaggtcattgactgaataccttcaaaatgtggagcaaaagaaaaggcagctg
gaggagtctgtggattccctcagtgaagaactagtccagcttcgagcacaagagaaggtg
catgaaatggaaaaggagcatttgaataaagttcagactgcaaatgaagtcaagcaagcc
gttgaacagcagatccaaagccacagagaaacacatcaaaaacagatcagtagtttgaga
gatgaagtcgaggcaaaagaaaaacttatcactgatcttcaagaccagaaccagaagatg
gcattagagcaagggcgcctgagagcggagcacgagaagctgaaagctacagagcaggac
aaaagcagaaagctacgtgaacttacggttatgcaagatagacgagaacaagcgagacaa
gacctgaagggtttggaagagacggtggcgaaggaacttcagactttacacaacctgcgg
aagctctttgttcaggacctggccaccagggttaaaaagagcgccgaggttgattcggac
gacaccggaggcagtgctgctcagaagcaaaaaatctcctttctcgagaataatcttgaa
caactcaccaaagtccacaaacagctggtacgtgataacgcagatcttcgctgtgagctt
cctaagctggaaaagcgactcagagctacagctgagagagtgaaggctttggagtcggca
ctgaaagaggccaaagaaaatgcatctcgcgatcgcaaacgctatcagcaggaagtagat
cgtataaaggaagcagtcaggtcaaagaatatggccagaagagggcattctgcacaaatt
gctaaacctattcgtcctgggcaacatccggcagcttctccggctcatcccagtgcagtt
cgtgggggaggtgcacctgtgcagaacggcccgccggcggccgtgcgaggcggaggaggt
gttaaaagtaattga

DBGET integrated database retrieval system