KEGG   Delphinapterus leucas (beluga whale): 111164116
Entry
111164116         CDS       T05885                                 

Gene name
IRF9
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04621  NOD-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle05160  Hepatitis C
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111164116 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111164116 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111164116 (IRF9)
   04625 C-type lectin receptor signaling pathway
    111164116 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111164116 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111164116 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111164116 (IRF9)
   05171 Coronavirus disease - COVID-19
    111164116 (IRF9)
   05164 Influenza A
    111164116 (IRF9)
   05162 Measles
    111164116 (IRF9)
   05168 Herpes simplex virus 1 infection
    111164116 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111164116 (IRF9)
   05169 Epstein-Barr virus infection
    111164116 (IRF9)
   05165 Human papillomavirus infection
    111164116 (IRF9)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    111164116 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 111164116
NCBI-ProteinID: XP_022409174
UniProt: A0A2Y9LHR1
LinkDB
Position
Unknown
AA seq 479 aa
MASGRTRCTRKLRNWVVEQVESGQFPGVCWEDAAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDSEGPAIWKTRLRCALNKSSEFQEVPENGHRDGAEPYKVYRLLPPGTL
PAQPGTQKSPSKRHHSSVSCERKEDEVTTKNCILSPSLLQDPLKNELVETSGGTAYSDSG
SSSNSPEPQEGRDTAEAPLQGDLVSPELLPPPGSDYSLLLTFIYEGRVVGEAQVQSLDCR
LVAEPSGSQCGMEQVIFPKPGPREPTQRLLSQLKRGVLVASNSRGLFVQRLCPIPISWSA
PQAPPGPGPHLLPSNECVELFRTAYFCRDLARYFQGLGPAPEFQVTLNFWEESPGPNHTP
QSLITVQMEQAFARHLLEKTPEDQAAILSLVQSLEDPXPPFPLSVPPICFERASSSTLST
CLPCYFAPGPLNPPDISASGPLHLLVLLTKTLFLQVLSTLRAGAPTLSYLCPSVNTCEH
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcatcaggcaggacacgttgcacccggaagctccggaactgggtggtggagcaggtg
gagagcgggcagttcccaggagtgtgctgggaagatgcggccaagaccatgttccggatt
ccctggaagcacgcaggcaagcaggacttccgggaggatcaggatgccgccttcttcaag
gcctgggcgatatttaagggaaagtacaaggagggggactcggaaggccctgctatctgg
aagactcgtctgcgctgtgctctgaacaagagttctgagttccaggaggttcctgagaat
ggccacagggatggggctgagccctacaaggtgtaccggctgctgccacctggaaccctc
cccgctcagccagggacccagaaatcaccatcaaagcgacaccacagttctgtgtcctgt
gagaggaaggaggacgaggttaccacgaagaactgcatactcagcccctccttgctccag
gaccccctcaaaaatgagctggtggagaccagtgggggaacagcctattcagactccggg
agcagcagcaacagccctgagcctcaggaaggtagggacacagctgaggcccctctccaa
ggagatctggtgtccccagagcttctgccccctccaggttcagactactccctgctgctc
accttcatctacgaggggcgcgtggtgggtgaggcccaggtgcagagcctggactgccgc
ctcgtggctgagccctcgggctcccagtgcggcatggagcaggtgatatttcccaaaccc
ggcccgcgagagcccacccagcgcttgctgagccagctcaagagaggggtcctggtggcc
agcaactcccgaggcctctttgtgcagcgcctttgccccatccccatctcctggagcgcg
ccccaggctccacctggtccaggcccgcacctgctgcccagcaacgagtgcgtggagctc
ttcagaaccgcctatttctgcagagacctggccaggtacttccagggcctgggccccgca
cccgagttccaggtgacactgaatttctgggaggagagccctggccccaaccacacccca
cagagtcttatcacagtgcagatggagcaggcctttgcccgacatttactggagaagact
ccagaggatcaggcagccatcctgtccctggtgcagagcctggaggacccanngcctcct
tttcctctctctgttccacccatctgctttgagagagcctcttcctccacgctctcgacc
tgcctcccatgttactttgctccaggccccctgaacccaccagacatttctgcctcagga
cctttgcacttgctggttcttttgactaaaacactcttccttcaggtcctaagcacctta
agggcaggtgcccccactttatcatatttgtgccccagcgtgaacacttgtgaacactga

DBGET integrated database retrieval system