KEGG   Delphinapterus leucas (beluga whale): 111164167
Entry
111164167         CDS       T05885                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial isoform X1
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00020  Citrate cycle (TCA cycle)
dle00620  Pyruvate metabolism
dle01100  Metabolic pathways
dle03320  PPAR signaling pathway
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04931  Insulin resistance
dle04964  Proximal tubule bicarbonate reclamation
Module
dle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111164167 (PCK2)
   00020 Citrate cycle (TCA cycle)
    111164167 (PCK2)
   00620 Pyruvate metabolism
    111164167 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111164167 (PCK2)
   04151 PI3K-Akt signaling pathway
    111164167 (PCK2)
   04152 AMPK signaling pathway
    111164167 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111164167 (PCK2)
   04922 Glucagon signaling pathway
    111164167 (PCK2)
   04920 Adipocytokine signaling pathway
    111164167 (PCK2)
   03320 PPAR signaling pathway
    111164167 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    111164167 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111164167 (PCK2)
Enzymes [BR:dle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     111164167 (PCK2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 111164167
NCBI-ProteinID: XP_022409285
UniProt: A0A2Y9LIF0
LinkDB
Position
Unknown
AA seq 655 aa
MAAVYRPGLRLKWRGLSPWGWPSRRSIQTLRVLSGDLGQLPAKVRDFVENSARLCQPENI
HICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPAEFQQAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRTGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQVPGAPASSPTTPLSPGEPV
SQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLI
LGITNPAGKKRYVAAAFPSACGKTNLAMMQPALPGWRVECVGDDIAWMRFDSDGRLRAIN
PENGFFGVAPGTSATTNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTVTSWL
GKPWKPGDKEPCAHPNSRFCAPARQCPIIDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEA
FNWRHGVFVGSAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGRYLEHWLSMEGLKGTR
LPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICRRLDGEDSARETPIGLVPKEGALDLS
GLGAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALEGRVRRM
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccgctgtgtaccgccccggcctgcggcttaaatggcgtgggctgagcccctggggc
tggccctcacggcgcagtatccagaccctgcgagtactgagtggagacctgggccagctg
cctgctaaggttcgagacttcgtggaaaacagtgcccgcctgtgccaaccagagaacatc
cacatctgtgatgggaccgaggcagaaaacactgccacactaaccctgctggaacagcag
ggactcatccgaaagctcccaaagtacaacaactgctggctggcccgcacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcaacgggacacggtg
cccctcccggctggcggggcccgtgggcagctgggcaactggatgtccccagctgagttc
cagcaagccgtggatgagaggtttccaggctgcatgcaaggccgaaccatgtatgtactg
ccattcagcatgggtcccgtgggctccccactgtcccgcaccggagtgcagctcacggac
tccgcctacgtggtggcaagcatgcggattatgacccggctggggacgcccgtgcttcag
gccctgggagatggcgactttgtcaagtgtctgcactccgtgggccagcccctgactggg
caagtgcctggtgcccctgccagcagccccacgaccccattgtccccaggggagccggtg
agccagtggccatgcaacccagagaaaaccctgattggccatgtgcccgaccagcgggag
atcgtctccttcggcagcggctatggtggcaactccctgctgggcaagaagtgctttgcc
cttcgcatcgcctctcggctggcccgggatgagggctggctggcggagcacatgctgatc
ctgggtatcaccaaccccgcggggaagaagcgctatgtggcagctgccttccccagcgcc
tgtggcaagacaaacctggccatgatgcagccggcacttccaggctggagagtggagtgt
gtgggggatgacatcgcctggatgaggtttgacagtgatggtcgactccgggccatcaac
cctgagaacggcttctttggggtggcccccggcacctctgccaccaccaatcccaatgcc
atggccacaatccagagtaacacccttttcaccaacgtggctgagaccagcgatggcggc
gtatactgggagggcattgaccagcctcttccacccggcgtcaccgtgacctcctggctg
ggcaaaccctggaaacctggtgacaaggagccctgtgcacatcccaattctcgcttttgt
gccccggctcgccagtgccccatcatagacccagcctgggaggcccctgagggtgtcccc
attgacgccatcatctttggaggccgcagacccaaaggagtccccctggtatatgaggcc
ttcaactggcgccatggggtgtttgtgggcagcgccatgcgctcggaggccactgccgcg
gctgaacacaaagggaaggtcatcatgcacgacccatttgccatgcggcccttttttggc
tacaactttgggcgctaccttgaacactggctgagcatggaggggctcaaggggacccgg
ctgccccgcatcttccatgtcaactggttccggcgcgacgaggcaggccacttcctgtgg
ccaggctttggagagaatgctcgggtgctagactggatctgccggcgcctagacggggag
gacagtgcccgagaaacgcccattgggctggtgccaaaggaaggtgccttggatctcagc
ggcctgggagccatagacaccacccagctgttctcgctccccaaggacttctgggaacag
gaggttcgtgacattcggagctacctgacagagcaggtcaaccaggatctgcccaaggag
gtgttggctgagctggaggccctggagggacgcgtgcgcagaatgtga

KEGG   Delphinapterus leucas (beluga whale): 111186712
Entry
111186712         CDS       T05885                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP] isoform X1
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00020  Citrate cycle (TCA cycle)
dle00620  Pyruvate metabolism
dle01100  Metabolic pathways
dle03320  PPAR signaling pathway
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04931  Insulin resistance
dle04964  Proximal tubule bicarbonate reclamation
Module
dle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111186712 (PCK1)
   00020 Citrate cycle (TCA cycle)
    111186712 (PCK1)
   00620 Pyruvate metabolism
    111186712 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111186712 (PCK1)
   04151 PI3K-Akt signaling pathway
    111186712 (PCK1)
   04152 AMPK signaling pathway
    111186712 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111186712 (PCK1)
   04922 Glucagon signaling pathway
    111186712 (PCK1)
   04920 Adipocytokine signaling pathway
    111186712 (PCK1)
   03320 PPAR signaling pathway
    111186712 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    111186712 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111186712 (PCK1)
Enzymes [BR:dle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     111186712 (PCK1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 111186712
NCBI-ProteinID: XP_022453263
UniProt: A0A2Y9QCP9
LinkDB
Position
Unknown
AA seq 687 aa
MSLTNCSANRNWLSFFLPAPTVWRGATRTRRVELGGIRGCFCSGSLCFFYGRKLGARAPQ
PSPAEMPPQLSGGLSYSARVVQGTLDSLPQAVREFVESSAKLCWPDQIHICDGSEDEDRQ
LLGRMEEEGVIKRLRKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQLGR
WMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSRIGIELTDSPYVVTSMRIMTR
MGTPVLEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPEMTLIAHLPDRREIISFGSGY
GGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPKGQKKYFAAAFPSACGKTNLAM
MNPTLPGWKVECVGDDIAWMKFDQQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNT
IFTNVAETSDGGVYWEGIDQPLASGIKLISWKGKEWDPKDGEPCAHPNSRFCTPASQCPI
IDPDWESPDGVPIEAIIFGGRRPVGVPLVYEALSWHHGVFVGAAMRSEATAAAEHKGKVI
MHDPFAMRPFFGYNFGQYLAHWLSMAQRPEAKLPKIFHVNWFRKDKAGRFLWPGFGENSR
VLEWMFNRVGGEGGAKLTPIGYIPDEDALDLRGLGDVSMKELFHISKEFWEEEVEDIQKY
LEGQVNADLPHEIESEVLALKQRISQM
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgtctctcacaaactgcagtgctaacaggaactggctttcttttttcctcccagccccg
actgtctggcgaggtgcaacccggacaaggcgcgtggagttggggggcatccggggttgt
ttttgttcaggaagcctgtgctttttctatggcaggaaacttggcgcccgtgcgcctcag
cccagccccgcagagatgcctccccagctctcaggtggtctcagctactcagccagagtt
gtccagggcaccctggacagcctgccgcaggccgtgagagagttcgtggagagcagcgcc
aagctgtgctggcccgaccagatccacatctgcgacggctccgaggatgaggacaggcag
ctgctgggccgcatggaggaggagggtgtgatcaagaggctgaggaagtatgacaactgc
tggttggctctcactgaccccagggatgtggccagaattgaaagcaagacggtcatcatt
actcaagagcaaagagatacggtgcccatccccaaaaccggcctcagccaactgggtcgc
tggatgtccgaggaggattttgagaaagcgttcaatgcccgatttccagggtgcatgaaa
ggtcgcaccatgtacgtcatcccattcagcatggggcccctgggctcgcctctgtccagg
atcggcattgagctgacagattcgccctacgtggtgaccagcatgcgcatcatgacgcga
atgggcacgcccgtcctggaagcgctgggggacggggagtttgtcaagtgcctccattcc
gtggggtgccctttgcctttaaaaaagcctttggttaacaactgggcctgcaacccggag
atgacactcatcgcccacctgcccgaccgcagagaaatcatctcctttgggagtgggtac
ggcgggaactcgctccttgggaagaagtgctttgctctcaggatggccagccggctggcc
aaggaggaggggtggctggcagagcacatgctgattctgggcataaccaaccccaagggc
cagaagaagtacttcgcggctgcctttcccagcgcctgcgggaagaccaacctggccatg
atgaaccccaccctcccagggtggaaagtagagtgtgtgggggatgacatcgcctggatg
aaatttgaccaacaaggtaacttgcgggccatcaacccagagaacgggttttttggtgta
gctcctggaacctctgtgaagacaaaccccaatgccatcaagaccatccagaagaacacc
atcttcaccaacgtggccgagaccagcgatgggggcgtttactgggaaggcattgaccag
ccactggcctcgggcatcaaactcatttcctggaagggcaaggagtgggaccccaaggat
ggggagccttgcgcccaccccaactcgcggttctgcacccctgccagccagtgccccatc
attgaccctgactgggagtctccggacggcgtgcccatcgaggccatcatcttcggaggg
cgccgacctgttggtgtccctctggtctatgaggctctcagctggcatcatggcgtgttt
gtgggtgcggccatgaggtcggaggccacggcagcggcagaacacaagggcaaagtcatc
atgcacgaccccttcgccatgcggcccttcttcggctacaacttcggccagtacctggct
cactggctcagcatggcccagcgccccgaggccaagctgcccaagatcttccacgtcaac
tggttccggaaggacaaggccggcaggttcctctggccgggcttcggcgagaactccagg
gtgctggagtggatgttcaaccgcgtcggcggggaagggggcgccaagctcacgcccatc
ggctacatccccgacgaggacgccctggaccttcggggcctgggggatgtcagcatgaag
gagctcttccacatctccaaggagttctgggaggaggaggtggaagacatccagaagtac
ctggaggggcaggtgaacgccgacctcccccacgagatcgagagcgaggtcctggccctg
aagcaaagaatcagccagatgtag

DBGET integrated database retrieval system