KEGG   Delphinapterus leucas (beluga whale): 111164202
Entry
111164202         CDS       T05885                                 

Gene name
NFATC4
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04625  C-type lectin receptor signaling pathway
dle04921  Oxytocin signaling pathway
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111164202 (NFATC4)
   04022 cGMP-PKG signaling pathway
    111164202 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111164202 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111164202 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111164202 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    111164202 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111164202 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    111164202 (NFATC4)
   05161 Hepatitis B
    111164202 (NFATC4)
   05163 Human cytomegalovirus infection
    111164202 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111164202 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111164202 (NFATC4)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111164202 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 111164202
NCBI-ProteinID: XP_022409327
UniProt: A0A2Y9LQG1
LinkDB
Position
Unknown
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGSGEELDSEDTPPCCRLGLGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGSGGAGGGRVLECPSIRITS
ISPSPDPPAALEDNPDAWGEGSPRDYPPPEGFGGYREAGGQGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPA
PPLPLVRDPGSPGPFDYTGAPPAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLPSGVEE
AGAPPGGPRKEVAGMDYLAVPSPLAWSKARTGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPIVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVISVQTASVPIECSQRSAQELPQVEAYSPSACSVTG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTIPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDASLRGFPSASGPHFGSDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGPRMFPETGGTTGCARPPPV
SFLPRPFPSDPYGGRGSPFPLGLPFPPPAPFRPPLPSSPPLEGPFAPQSSVHPPPAEGYS
EVGPSYGPGEGAPEQEKSRGGYGGSFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcagcaagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcgggggggtcgggggaagaactggactcagaggacacc
ccaccatgctgccgtctgggcctgggggagccccctccctatggtgctgcccctattggc
attccccggcccccaccccctcggcctggcatgcactccccaccaccccgcccggccccc
tcacctggcacttgggagagccaaccagcccggtcagtgaggctgggggggccgggaggg
ggctccgggggggctgggggaggccgtgttcttgagtgtcccagcatccgcatcacctct
atctctcccagtcctgacccgccagctgcgctggaggacaacccagatgcctggggggaa
ggatcccccagggattaccccccaccagaaggctttggaggctaccgagaggcagggggc
cagggcgggggtcccttcttcagcccgagccctggcagcagcagcctgtcttcctggagc
ttcttctcagatgcctctgacgaggcagccttgtatgcagcctgtgacgaggtggagtct
gagctaaatgaggcggcctcccgctttggcctaggctccccactgccctcaccccgggcc
tcccctaggccgtggacccccgatgacccctggagcctgtatggtccgagccctggaggc
cggggtccagaggatagctggctactcctcagcgctcctgggcccaccccagcttcccca
cgacctgcctctccatgtggcaagcggcgctattccagctcaggaaccccatcttcggct
tccccagctctgtcccgccgaggcagcctaggggaggaggggcctgagccacctccagca
cccccattgcctctggtccgggacccgggctcccctggcccctttgactacacgggggcc
ccaccagccgagagcatccctcagaagacccggaggacttccagcgagcaggcggtggcc
ctgcctcggtctgaggagcctgccccgtgcaatgggaagctgccttcgggagtagaggag
gctggggctcctcccgggggtcctcggaaggaggttgccggcatggactacctggcggtg
ccttccccactggcttggtccaaggcccggactgggggacacagccccatcttcaggacc
tctgccctccccccgctggactggcctctgcccagccagtatgaacagctggagctgagg
atcgaggtgcagcccagagcccaccaccgggcccactatgagacagagggcagccgggga
gctgtcaaagctgcccctggtggtcaccccattgtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcatcggcaccgcagatgagaggaacctgcgacctcacgct
ttctatcaggtgcaccgtatcacgggcaagatggtggccacggccagctacgaagctgta
gtcagtggtaccaaggtgttggagatgaccctgctccctgagaacaacatggcagccaac
attgactgtgccggaatcctgaagcttcggaattcagacattgagctgcggaagggtgag
acggacatcgggcgcaagaacacacgcgtgcggctggtattcagggtacacgtgccccaa
ggcagcgggaaggtcatctcggtgcagacagcatcggtgcccatcgagtgctcccagcgc
tcagctcaggagctgccccaggtggaggcctacagccccagtgcctgctccgtgacggga
ggggaggaactagtgctgactggctccaacttcctgcctgactccaaggtggtgttcatc
gagaggggccctgatggaaagctgcaatgggaggaggaggccacagtgaaccggttgcag
agcaatgaggtgacgctgaccctgaccatccccgagtacagcaacaagcgggtgtcccgg
ccagtccaggtctacttttacgtctccaacgggcggaggaagcgcagtcctacccagagt
ttcaagttcctgcctgtgatcttcaaggaggagcctctaccggacgcatctctccggggc
ttcccttcagcatcgggcccccactttggctctgacatggacttctcaccacccaggccc
ccctacccctcctatccccatgaagaccctgcttatgaaactccttacctgtcagaaggc
ttcagctatggcacgccccctctgtacccccagacggggcccccgccatcctacagacct
ggcccgcggatgttccctgagactgggggtaccacaggttgcgcccgcccacctccagtc
tcattccttccccggcccttccctagtgacccctatggaggacggggctccccctttccg
ctggggctgccgttccctcctccagcccccttccggcctccactaccttcatccccacca
cttgaaggccccttcgctccccagagcagtgttcaccccccacctgccgagggatacagt
gaggtagggccaagctatggccctggggagggggctccggagcaggagaagtccaggggt
ggctacggcggcagcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctccc
gcctga

KEGG   Delphinapterus leucas (beluga whale): 111167284
Entry
111167284         CDS       T05885                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04380  Osteoclast differentiation
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04921  Oxytocin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05135  Yersinia infection
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111167284 (NFATC1)
   04310 Wnt signaling pathway
    111167284 (NFATC1)
   04024 cAMP signaling pathway
    111167284 (NFATC1)
   04022 cGMP-PKG signaling pathway
    111167284 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111167284 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111167284 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    111167284 (NFATC1)
   04660 T cell receptor signaling pathway
    111167284 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    111167284 (NFATC1)
   04659 Th17 cell differentiation
    111167284 (NFATC1)
   04662 B cell receptor signaling pathway
    111167284 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111167284 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111167284 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111167284 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111167284 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111167284 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111167284 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111167284 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    111167284 (NFATC1)
   05161 Hepatitis B
    111167284 (NFATC1)
   05163 Human cytomegalovirus infection
    111167284 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111167284 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111167284 (NFATC1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111167284 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 111167284
NCBI-ProteinID: XP_022415678
UniProt: A0A2Y9MEB2
LinkDB
Position
Unknown
AA seq 928 aa
MPSTSFPVPSKFPLGPPAAVCGSGETLGPSAPAGGTMKSAEEEHYSYVTSGIGSGLPLSS
AHPSLPAPCHGLQTSAPGVSTAGYGAALDGGPSSYFLSSGGVRPNGAPALESPRIEITSY
LGLHHGNGQFFHDADAEDVLPSSKRSPSTATLNLPSLEAYRDPSCLSPASSLSSRSCNSE
ASSYESSFSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACGLLGSPRHSPSTSPRTS
VTEESWLGACTSRPSSPCNKRKHGLNGRQLPCSPHPSPTPSPQGSPRASAADAAWLGNTT
QYAGSAIVAAINALSTDSSLDLGDGVPVKARRTALDHSPSVALKVEPAGEDLGATPPTSD
FAPEEFPSFQHIRKGAFCDQYLSVPQHLYPWARPRSPTSYTSPSLPALDWQLPSHSGPYE
LRIEVQPKSHHRAHYETEGSRGAVKALAGGHPSVQLHGYMESEPLTLQLFIGTADDRLLR
PHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELR
KGETDIGRKNTRVRLVFRVHVPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSAASGP
VLGGKRMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKIDGALCKPNSLVVEIPPFRNQR
ITSPVQVNFYVCNGKRKRSQYQHFTYLPANVPIIKTEPSDDYEPALTCGPMSQGLSPLPK
PCYGQPLALPPDPGSCLAPGFPPRPQSSTSPELHDLSCAPYGPATAGPGHGPLGLPRPVG
GVLASQEAPRPAGVPPGPPQPPPPAPLQPQVSPPSSGSCSPGCRPALCPHSPSSPLPPGT
QEPTRLQPCGPARPPGTGHQQQQPSEVPSSEPAATRPLPAPEVREDSNHSLAPIPVTVKR
EPQELDPLDLDDVNEIIRNDLSSTNLHS
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccaagtaccagttttccagtcccttccaagtttccactcggccctccggctgcagtc
tgcgggagcggagaaactttggggccctctgcgcccgccggcggcaccatgaagtcggca
gaggaagagcactacagttacgtcacctccggcatcggctctggcctgcccctctcctcc
gcccacccctcgctgccagccccgtgccacggcctgcagacctcggccccgggcgtctcc
accgcaggctacggggccgccctggacggcgggccctcgagctacttcctctcctccggc
ggagtcaggcccaacggggccccagccctggagagccctcgcatcgagatcacctcctac
ctggggctgcaccacggcaacggccagttcttccatgacgcggacgcggaagacgtcctt
cccagctccaagcggtccccgtccacggccactctgaacctgcccagcctggaggcctac
cgcgacccctcgtgcctgagcccggccagcagcctgtcgtcccgcagctgcaactccgag
gcctcgtcctacgagtccagcttctcgtacccgtacgcgtccccgcagacgtccccgtgg
cagtccccctgcgtgtcccccaagaccacagaccccgaggagggcttcccccgtggcctg
ggggcctgcggcctgctcgggtccccgaggcactcgccctccacgtcgccgcgcaccagc
gtcactgaggagagctggctgggggcctgcacttccaggccctcgtccccctgcaacaag
cggaagcatggcctcaacggccggcagctgccctgctccccccacccctcgcccacgccg
tccccacaagggtcgccacgggccagcgccgccgacgccgcctggctgggcaacaccacg
cagtacgccggctcggccatcgtggccgccatcaacgccctgagcactgacagcagcctg
gacctgggcgacggcgtccccgtcaaggcccgcaggaccgccctggaccactcgccctca
gtggcgctcaaggtggagccagccggggaggacctgggggccacgccgcccacgtctgat
tttgcacctgaggagttcccatccttccagcacatccgcaagggcgccttctgcgaccag
tacctgtcggtgccgcagcacctgtacccgtgggcccggccgaggtccccaacgtcctac
accagcccgtctctccctgccctcgactggcagctgccgtcacactcaggaccgtacgag
ctgaggatcgaggtgcagcccaagtcccaccacagagctcattacgagacggaggggagc
cggggggccgtgaaggcgttggccggaggacaccccagcgtgcagctgcacggctacatg
gagagcgagccgctcaccctgcagctgttcatcgggacagcggatgaccggctgctgagg
ccccacgccttctaccaggtgcaccggatcacgggcaagaccgtctccaccaccagccac
gaggccatcctctccaacaccaaggtcctggaaatcccgctgctgccggaaaacaacatg
cgagcaatcatcgactgcgccgggatcctgaagctcagaaactctgacatcgagctccgc
aagggggagacagacatcgggaggaagaacacgcgggtgaggctggtcttccgcgtccac
gtcccgcagcccaatggccggacgctgtcgctgcaggtcgcctccaaccccatcgagtgc
tcccagcgctcggcccaggagctgcccctcgtggagaagcagagcgcggccagcggcccc
gtcctcggtgggaagaggatggtcctgtccggccacaactttctgcaggactccaaggtc
attttcgtggagaaagcaccagacggccaccacatctgggagatggaggcgaaaatcgac
ggagccctgtgcaagccgaattcgctggtggtggagatcccgccttttcgcaaccagagg
ataaccagccccgtccaagtcaacttctacgtctgcaacgggaagcggaagaggagccag
taccagcacttcacctacctgcccgccaatgttccgatcataaaaacggagcccagtgat
gattacgagcctgccctcacctgtggaccaatgagccagggcctgagcccgctccccaag
ccctgctacggccagccgctcgccctgccgcccgacccgggctcctgcctcgcgcccggc
ttcccgccccgtccacagagcagcaccagccctgagctccacgacctctcctgcgccccc
tacggcccggccacggccggcccgggccacggccccctcggacttccgcggccagtcggc
ggggtcctcgccagccaggaggcgccgagacccgcgggcgtgcctcccgggcccccccag
ccgccgccccccgccccgctgcagccacaggtgagtccgccgtcaagtggtagctgctcc
ccggggtgccggccagcgctctgtccccacagtccctcctctccgctaccgcccgggacc
caagagccgacccgcctgcagccctgcggccccgcgcgcccccccgggacgggccaccag
cagcagcagccgtccgaggttccgagcagcgagcctgcagccacccggcccctgccagcg
cccgaggtgcgtgaggacagtaatcatagtctggcccccattcccgtaacggtcaagcga
gagcctcaggagctggacccgctggacctggacgacgtaaacgagataatacgaaatgac
ctctccagtaccaacctccactcgtag

KEGG   Delphinapterus leucas (beluga whale): 111179609
Entry
111179609         CDS       T05885                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04625  C-type lectin receptor signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04921  Oxytocin signaling pathway
dle05135  Yersinia infection
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111179609 (NFATC3)
   04310 Wnt signaling pathway
    111179609 (NFATC3)
   04022 cGMP-PKG signaling pathway
    111179609 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111179609 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111179609 (NFATC3)
   04660 T cell receptor signaling pathway
    111179609 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    111179609 (NFATC3)
   04659 Th17 cell differentiation
    111179609 (NFATC3)
   04662 B cell receptor signaling pathway
    111179609 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111179609 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    111179609 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111179609 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111179609 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111179609 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    111179609 (NFATC3)
   05161 Hepatitis B
    111179609 (NFATC3)
   05163 Human cytomegalovirus infection
    111179609 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111179609 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111179609 (NFATC3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111179609 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 111179609
NCBI-ProteinID: XP_022439113
UniProt: A0A2Y9P9Q5
LinkDB
Position
Unknown
AA seq 1073 aa
MTTANCGAHDELDFKLVFGEDGAPPPPPPVSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSSSFQLQGHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDTHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWNQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATVLPGKLELCSD
DQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPTHFGQYELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIKEKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQERREEIDLSSVPSLPH
PVQTQRPSSDTGHLHDSVLSAQRSLVCPIQLTYASMVTSTHLPQLQCRDESAGKEQHMIP
SSVVHQPFQVTPTPPVGSSYQPMQTNVVFNGPTCLPVNAASSQEFDPVLFQQDAALPNLI
NLGCQPPSSIPFHSSNSGSTGHLLAHTPHSVQTLPHLQSMGYCCSNTGQRSLSSPVADQV
TGQPSPQLQPITYGPSHSGTATTASQATSHPLASSPLSGPPSPQLQPMPYQSPSSGTASS
QSLATRMHSGQHSTQAQSTGQGGLSAPSSLLCHSLCDPASFPPDEATVNIKPEPEEQEPN
FSTIGLQDITLDDVNEVIGRDMSQISVSQGTGASRQAALPGPDSLDLGRSDGL
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgactttaaactcgtctttggcgag
gacggggcgccgccaccgccgcccccggtctcgcggcctgcagatcttgagcccgatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcatcatcgtttcagctc
caaggtcacaaaaactatgaaggaacttgtgaaattcctgaatctaaatacagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatccatctctcctaactgt
catcaagaaattgatactcatgaagatgacctacacataaatgacccagaaagggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tcccttagtcctagtcctgccagcagcatctcttctaggagctggttctcagatgcgtct
tcttgtgaatctctttcacatatttatgatgatgtggattcggagttgaatgaagctgct
gcccgatttactctcggatcccctctgacttctcctggtggctctccaggaggctgccct
ggagaagagtcctggaatcaacagtatggacttggacactccttgtcacctaggcaatct
ccttgccactctcctagatctagtgtcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcctacttccccttgtgggaaacggcggcactctagtgctgag
gtttgttatgctgggtccctttcgcctcatcactcacctgttccttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggctcaatgcttctgtccagggtggatcaggc
cttggccctgcactttttccatttcagtactgtgtagagactgatattcctctgaaaaca
aggaagacttctgaagatcaagctaccgtactaccaggaaaattagagctctgttcagat
gaccaagggaatctttcaccatcccgggaaacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggtcacacccctatatttcgcacgtcttcattacctccacta
gactggcctttaccaactcattttggacaatatgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggagcagtaaaagcgtctact
gggggacatcctgttgtgaagctcctgggctatagtgaaaagccgataaatctacagatg
tttattggaacagcagatgatcgatatttacggcctcatgcattttaccaggtgcatcgg
atcactgggaagacagttgctactgccagccaagagataataattgccagcacaaaggtt
ctggaaattccacttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccaatggaaaagtcctt
tctctgcagacagcttctatacctgttgaatgctcccagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtt
actggatctaattttcttccagaatccaaaatcatctttcttgaaaaaggacaagatgga
cgacctcagtgggaagtagaagggaaaataatcaaagaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagaacgcagagaagagattgatttgtcttcagttccatcattgcctcat
cctgtccagacccagaggccttcttcagatacaggacacctacatgacagtgtactgtct
gcacagagaagcttggtttgtcccatccagctaacatatgcatccatggtaacctcaacc
catctgccacagttgcagtgtagggatgagagtgctggtaaagaacagcatatgatacct
tcttcagttgtgcaccagccttttcaagtcacaccaacacctcctgtagggtcttcctat
cagcctatgcaaactaatgtcgtattcaatggaccaacttgtcttcctgttaatgctgcc
tctagtcaagaatttgatccagttttgtttcagcaggatgcagctcttcctaatttaata
aatcttggctgtcagccaccatcatccataccttttcattcttcaaattcaggctcaaca
ggacatctcttagcccacacacctcattctgtgcagaccttgcctcatctgcagtcaatg
ggatactgttgttcaaacacaggacaaagatctctttcttctccagtggccgatcaggtt
acaggtcagccttcccctcagttacaacccattacgtatggtccttcacattcagggact
gctacaacagcttcccaagcaacctctcatcccttggccagttcaccgctttctgggcca
ccatctcctcagctacagcctatgccttaccagtctcctagctcaggaactgcctcatca
cagtctctagccaccagaatgcattctggacagcactcaactcaagcacaaagtacaggc
cagggaggtctttctgcaccttcatccttattatgtcacagtttgtgcgatccagcttca
tttccacctgatgaggcaactgtgaacattaaacctgaacctgaagagcaggaacctaac
ttttctacaattggtcttcaggacatcactttagatgatgtgaacgaggtaattgggaga
gacatgtcccagatttctgtttcccaaggaacaggggcgagcaggcaggctgccctccca
ggtcctgattccctggatttaggaagatccgacgggctctaa

KEGG   Delphinapterus leucas (beluga whale): 111186778
Entry
111186778         CDS       T05885                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04921  Oxytocin signaling pathway
dle05135  Yersinia infection
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111186778 (NFATC2)
   04370 VEGF signaling pathway
    111186778 (NFATC2)
   04022 cGMP-PKG signaling pathway
    111186778 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111186778 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111186778 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    111186778 (NFATC2)
   04660 T cell receptor signaling pathway
    111186778 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    111186778 (NFATC2)
   04659 Th17 cell differentiation
    111186778 (NFATC2)
   04662 B cell receptor signaling pathway
    111186778 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111186778 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    111186778 (NFATC2)
   04380 Osteoclast differentiation
    111186778 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111186778 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111186778 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186778 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    111186778 (NFATC2)
   05161 Hepatitis B
    111186778 (NFATC2)
   05163 Human cytomegalovirus infection
    111186778 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186778 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111186778 (NFATC2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111186778 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 111186778
NCBI-ProteinID: XP_022453373
UniProt: A0A2Y9QD19
LinkDB
Position
Unknown
AA seq 943 aa
MDAQEPQPDPDGGGAPGHEPGGSPQDEFDFSILFDYDYLNPIEEEPNAHKVASPPSGLAY
PDDVLDYGLKPYSPLDSLSGEPPHRLGEPDRVGPQNFLCPAKPAGASGLSPRIEITPSHE
LMQSGGPFRMRDTGLVVEQPPLPGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTGLAEDSCLGRHSPVPR
PASRSSSPGTKRRHSCAGALVAPLPGASPQRSRSPSPQPRDDGAPAGYPPAAGSAVLMDA
LNSLAADSPCGIPPKMWKTSPDPSPVSSAPSKAGLPRHIYPAVEFLGPCEQEERRNSAPE
SILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYET
EGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTT
TSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVF
RVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAE
SKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHVRTSVKVNFYVINGKRK
RSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPQHPMVAESPSCLVATMA
PCQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLV
HAGSQGQSSALLHSSPANQQASPVIHYSPTSQQLRCGSHQEFQHIVYCENFAPGTTRPGP
PPVSQGQRLSPGSYPTVIQQQNAASQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLD
DGKMLVFLTACEFGAPKRLPSKFTARPGYLPSPVWASVSPSLI
NT seq 2832 nt   +upstreamnt  +downstreamnt
atggacgcccaggagccgcagcccgatcccgacggcgggggcgccccgggccacgagcct
ggaggcagcccccaagacgagttcgacttctccatcctcttcgattatgactatttgaat
cctatcgaagaagaaccgaatgcacataaggtcgccagcccaccctccggactcgcatac
cccgatgatgtcctggactatggcctcaagccatacagccccctagacagtctctctggc
gagcccccgcaccggttgggagagccggatagggtagggccccagaactttctgtgccct
gccaagccagcgggggcctcgggcctgagccctcggatcgagatcactccatcccacgaa
ctgatgcagtcaggggggcccttccgcatgagagacactggcctcgtggtcgagcagccg
cccctgccgggggtggccgccagcccgaggttcacgctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttcc
gacaccttctccccttacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccccagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccggcctcgctgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcgtcgcctggtaccaagcggaggcattcgtgcgcgggggccttg
gttgccccactgcccggagcctcaccccagcgctcgcggagcccctcgccgcagccccgg
gacgacggcgcccctgccgggtacccccccgcggctggctctgccgtcctcatggatgcc
ctgaacagcctcgctgccgactcaccctgtgggatcccccccaagatgtggaagaccagc
cccgacccgtcgccggtgtccagcgccccgtccaaggctggcctaccccgccacatctac
ccagccgtggagttcctggggccctgcgagcaggaggagaggaggaactcagcccccgag
tccatcttactggtgccaccaacttggcccaagcagctggtgcccgccattcccatctgc
agcatcccagtgactgcatccctcccaccacttgagtggccactctcccaccagtcaggc
tcctatgagctgaggatcgaggtgcagcccaagccacatcaccgagctcactacgagaca
gaaggcagccgaggggctgtcaaagctccgaccggcggccaccctgtggttcagctccat
ggctacatggaaaacaagccgctggggcttcagatcttcattgggacggccgacgagcgg
atccttaagccccatgccttctaccaggtacaccggatcacggggaaaacagtcaccacc
accagctacgagaagatcgtgggcaacaccaaagtcctggagattccgctggagccaaaa
aacaacatgagggcaaccattgactgtgcggggatcctgaagcttcggaatgcggacatt
gagctgcggaaaggcgagacggacatcgggaggaagaacacgcgggtgaggctggtgttc
cgggtgcacattccagagtccagcggaaggatcgtctccttgcagacagcatctaacccc
atcgagtgctcccagcgatccgcccacgagctgcccatggtggaaagacaagacatcgac
agctgcctggtctacgggggccagcagatgattctcacgggacagaacttcacggccgag
tccaaagtcgtgtttaccgagaagaccacagatgggcagcagatttgggagatggaggcc
acggtggataaagacaagagccagcctaacatgcttttcgttgagatccctgagtatcgg
aacaagcacgttcggacgtcagtgaaggtgaacttctatgtcattaacgggaaaagaaaa
cgaagtcagcctcagcactttacctaccatccagtcccagccatcaagacggagcccact
gatgaatacgaccccaccttgatctgcagccctgcccacgggggcctggggagccagcct
tactacccacagcacccaatggtggccgagtccccctcctgcctcgtggccaccatggct
ccctgccagcaattccgctcagggctctcatcccccgacgcccgctaccagcagcagaac
ccagcggccgtcctctaccagcggagcaagagcctgagccccagcctgctgggctaccag
cagccggccctcatggccgcccccctgtccctcgcggatgcccaccgctccgtgctggtg
cacgcaggctcccagggccagagctcggccctgctccactccagtccagccaaccagcag
gcctcaccggtgatccactactcgcccaccagccagcagctgcgctgcggaagccaccag
gagttccagcacatcgtgtactgcgagaacttcgcgcccggcaccacaaggcccggccca
ccccctgtcagtcaaggtcagaggctgagcccgggctcctacccgacggtcattcagcag
cagaatgccgcaagccaaagagccgccaaaaatggacctccggtcagtgaccaaaaggaa
gtattacccgcgggcgtgacaattaaacaggagcagaacttggaccagacctacttggat
gacggtaagatgcttgtttttctcactgcctgtgagtttggtgccccgaagcgtctcccc
agcaagtttactgcacggcctgggtatcttccttcacctgtttgggcctcagtgtccccc
tccttaatctga

DBGET integrated database retrieval system