KEGG   Delphinapterus leucas (beluga whale): 111164258
Entry
111164258         CDS       T05885                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle03430  Mismatch repair
dle03460  Fanconi anemia pathway
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    111164258 (MLH1)
   03460 Fanconi anemia pathway
    111164258 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164258 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111164258 (MLH1)
   05226 Gastric cancer
    111164258 (MLH1)
   05213 Endometrial cancer
    111164258 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111164258 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111164258 (MLH1)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     111164258 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c CAF1 Hfx_Cass5
Other DBs
NCBI-GeneID: 111164258
NCBI-ProteinID: XP_022409458
UniProt: A0A2Y9LW02
LinkDB
Position
Unknown
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVIKEGGLKLIQ
IQDNGTGIRKEDLEIVCERFTTSKLQSFEDLAHISTYGFRGEALASISHVAHVSITTKTA
DGKCAYRAHYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
SRYSVHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVESRLLGSNASRTYFTQTLLPGLTGPSGEVV
KSTTGVTLSSTAGSGDKVYAHQMVRTDCREQKLDAFVQPVSKALSSQPQAVVLEDRTAAS
SSGARQQDEEMLELSAPAEVAAKNQGLEEDAAKRTADSSEKRGPSSSPENPRKRHREGSD
LEMVEDASQKEMTAACTPRRRIINLTSILSLQEEISERGHETLREVLCNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDDEKECFESLGKECAMFYSIRKQYVSEESTLSGQQSEVPSSTPNPWKWTVEH
VVYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgctggtagcgggggttatccggcggctggacgagacagtggtaaaccgcatcgcg
gcaggggaagttatccagcgcccggctaatgccatcaaggagatgatagagaactgttta
gatgcaaaatccacaagtattcaagtggttattaaagagggaggcctgaagttgattcag
atccaagacaatggcaccgggatcaggaaagaagatctggagattgtgtgtgagaggttc
accacaagtaaactgcagtcctttgaggatttagctcatatttctacctatggctttcgg
ggtgaggctttggccagcataagccatgtggctcacgtcagcattacaaccaaaacagct
gacgggaagtgtgcatacagagcacattactcagatggaaagctgaaagctccacctaaa
ccatgtgcaggcaatcaagggacccagatcacggtagaggaccttttctacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatgggaaaattctggaagttgtc
agcaggtattcagtacacaattcaggcattagtttctcggttaaaaaacaaggtgagacg
gtagccgacgtcaggacactgcccaatgccacaaccgtggacaacattcgctccattttt
ggaaatgctgttagccgagaattgatagaagttgggtgtgaggataaaaccctcgccttc
aaaatgaatggctacatatccaatgcaaactactcggtgaagaagtgcatcttcttactc
ttcatcaatcatcgtctggtagagtcaacttccttaagaaaagccatagaaacggtgtat
gcagcatatttgcccaaaaacacacacccgttcctgtacctcagtttagaaatcagcccc
cagaatgtggatgtcaacgtgcaccccacgaagcacgaagttcacttcctgcacgaggac
agcatcctggagcgggtgcagcagcacgttgagagcaggctcctgggctccaacgcctcc
aggacctatttcacccagactttactaccaggtcttactggcccctctggggaagtggtt
aaatccacaacaggtgtgaccctctcatctactgctggaagtggcgacaaggtgtatgcc
caccagatggtccgcacagattgccgggaacagaaactcgatgccttcgtgcagcctgtg
agcaaggccctatccagtcagccccaggctgttgtcctagaggacaggacagctgcttct
agtagcggggccaggcagcaggatgaggaaatgcttgaactctcagctcctgctgaagtg
gctgccaagaatcagggcttggaggaggatgcagcaaagaggactgcagactcgtcagag
aagagagggccctcttccagccctgagaaccccagaaaaagacatcgggaaggctctgat
ttggaaatggtggaggatgcatcccaaaaggaaatgacagcagcttgtaccccccggaga
aggatcattaaccttaccagcattctgagtctccaggaagaaatcagtgagcggggacat
gagactctccgggaggtgctgtgtaaccactcatttgtgggctgtgtgaatcctcaatgg
gccttggcacagcatcagaccaagttataccttctcaacaccaccaaacttagtgaagaa
ctgttctaccagattctcatttatgattttgccaattttggtgttctgaggttatcggag
ccagcaccactctttgaccttgccatgcttgccttagatagtcctgagagtggctggaca
gaggaagatggtcccaaagaaggacttgccgaatacattgttgagtttctgaaaaagaag
gctgagatgcttgcagactacttctctttggagattgatgaggaagggaacctggttgga
ttaccccttctgatcgacaactacgtgccccccttggagggtctgcctatcttcattctc
cgactggccactgaggtgaactgggatgacgaaaaggaatgttttgaaagccttggtaaa
gaatgtgcgatgttttactccatccggaagcagtatgtgtctgaggagtcgaccctctca
ggccagcagagtgaagtgcccagctctactccaaacccctggaagtggactgtggagcat
gttgtctataaagccttccgctcacaccttctgcctccgaaacatttcacagaagatgga
aacatcctgcagcttgctaacctgcccgatctatataaagtcttcgagaggtgttaa

DBGET integrated database retrieval system