KEGG   Delphinapterus leucas (beluga whale): 111164323
Entry
111164323         CDS       T05885                                 

Gene name
CCR4
Definition
(RefSeq) C-C chemokine receptor type 4
  KO
K04179  C-C chemokine receptor type 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04062  Chemokine signaling pathway
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111164323 (CCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111164323 (CCR4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111164323 (CCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111164323 (CCR4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111164323 (CCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111164323 (CCR4)
   04050 Cytokine receptors [BR:dle04050]
    111164323 (CCR4)
   04090 CD molecules [BR:dle04090]
    111164323 (CCR4)
G protein-coupled receptors [BR:dle04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111164323 (CCR4)
Cytokine receptors [BR:dle04050]
 Chemokine receptors
  CC Chemokine
   111164323 (CCR4)
CD molecules [BR:dle04090]
 Proteins
  111164323 (CCR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 111164323
NCBI-ProteinID: XP_022409610
UniProt: A0A2Y9LJC7
LinkDB
Position
Unknown
AA seq 359 aa
MNPTGRADTTLDESIYNNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFLFGLLGNSVV
VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKLVYWMYLVG
FYSGIFFITLMSIDRYLAIVHAVFSLRARTLTYGVITSVATWAVAVLASLPGLVFSTCYT
EHNHTYCKTKYSFNSTRWKVLSSLEINVLGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNVVLFLDTLVELEVLQDCTFERHLDYAIQATETLAFVHCCLN
PVIYFFLGQKFRKYIVQLFKTCRGTSVLCQYCRFLPIYPDTPSSSYTQSTVDHDLRDAL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaaccccacgggcagagcagacaccaccctggatgaaagcatctataacaattattat
ctttatgaaagcatccccaaaccttgcaccaaggaaggtatcaaggcatttggggagctt
ttcctgccccccctctactccttggtctttctgtttggtctgcttggaaattctgtggtg
gttctggtcctgttcaagtacaagcggctcaagtccatgaccgacgtgtacctgctcaac
cttgccatctcggacctgctctttgtgctctcgctccctttctggggctactatgccgca
gaccagtgggtgttcgggctcggcctctgcaagctagtttactggatgtacctggtgggc
ttctacagcggcatattcttcatcacactcatgagcatcgacaggtacctggccattgtg
cacgcggtcttctccctgagagcgaggaccttgacttacggggtcatcaccagcgtggcc
acgtgggcagtggctgtgctcgcctccctcccaggccttgtgttcagcacgtgttatact
gagcacaaccacacctactgcaaaaccaagtattctttcaactccacgaggtggaaggtt
ctgagctccctggagatcaacgttctagggctggtgatccccttggggatcatgctgttc
tgctactccatgatcattaggaccttgcagcactgcaaaaatgagaagaagaacaaggca
gtgaagatgatctttgccgtggtggtcctcttcctggggttctggaccccttacaacgtg
gtgctcttcctggacaccctggtggagctggaggtccttcaagactgcacctttgagagg
cacctggactatgccattcaggccacagagaccctggcttttgttcactgctgccttaat
ccggtcatctactttttcctggggcagaaatttcgcaagtacatcgtacagctcttcaaa
acctgccggggcacttcggtgctctgccagtactgtaggttcctcccgatttaccccgac
acccccagctcatcttacacacagtccacggtggaccacgatctccgtgatgctctgtaa

DBGET integrated database retrieval system