KEGG   Delphinapterus leucas (beluga whale): 111164348
Entry
111164348         CDS       T05885                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04062  Chemokine signaling pathway
dle04068  FoxO signaling pathway
dle04137  Mitophagy - animal
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04722  Neurotrophin signaling pathway
dle04917  Prolactin signaling pathway
dle05213  Endometrial cancer
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111164348 (FOXO3)
   04151 PI3K-Akt signaling pathway
    111164348 (FOXO3)
   04152 AMPK signaling pathway
    111164348 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111164348 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    111164348 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111164348 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111164348 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111164348 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    111164348 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    111164348 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    111164348 (FOXO3)
   05223 Non-small cell lung cancer
    111164348 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111164348 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111164348 (FOXO3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    111164348 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 111164348
NCBI-ProteinID: XP_022409681
UniProt: A0A2Y9LLQ9
LinkDB
Position
Unknown
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGAGGPLGSGLLLEDSARLLAPGGQDPGSGPAPAAGALSG
GTQTPLQPQQTLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTATESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLADNLMDDLLDNIALPASQPSPPGGLMQRSSSFPYTTKGS
GLGSPTSSFSSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRSDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSSSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSASAHLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGSFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccaaagccggccgcgctcctgtacgtggcccctgcagaggccggagctc
caggggagcccggccaagccctcgggggaggcggccgctgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcggcggtagggccggctcggccatggcgatcggc
ggcggcgcgggcggcccgctgggctcagggctgctcctggaggactcggctcggctgcta
gctccgggagggcaggaccccgggtccgggccagcccccgcggcgggcgcgcttagcggg
gggacgcagacgccgctgcagcctcagcagacactgccaccgccgcagccgggggcggct
gggggctccgggcagccgaggaaatgctcgtcgcggcggaacgcctgggggaacctgtca
tacgctgacctgatcactcgcgccatcgagagctccccggacaaacgtctcactctgtcc
cagatctacgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaactctatccggcacaacctgtcgctgcacagccggttcatg
cgggttcagaatgaggggaccggcaagagctcatggtggatcatcaaccccgacgggggg
aagagtgggaaggcgccccggcggcgggccgtctccatggacaacagcaacaagtacacc
aagagccggggccgtgcagccaagaagaaggcagccctgcagaccgccaccgagtcagca
gacgacagtccctcccagctctccaagtggcccggcagccccacgtctcgcagcagtgat
gagctggacgcgtggaccgacttccgctcacgcaccaattccaatgccagcacagtcagt
ggccgcctgtcccctatcctggctagcacggagttggacgatgttcaggatgatgacgcg
ccactctcccccatgctctacagcagctcggccagcctgtccccctccgtcagcaagccg
tgcaccgtggagctgccccggctgaccgacatggcgggcaccatgaatctgaacgacggg
ctggccgacaacctcatggacgacctgctggacaacatcgcgctccctgcgtcccagccg
tcgccccccggggggctcatgcagcgcagctccagcttcccatacaccaccaagggctcc
ggcctgggctcccccaccagctccttcagcagcacggtgtttggcccctcgtctctgaac
tccctgcgtcagtctcccatgcagaccatccaagagaacaagccagccaccttctcttcc
atgtcgcactacggcaaccagacactccaggacctgctcacgtcggactcactcagccac
agcgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtct
gcccagaactcccgccggaacgtgatgcttcgcagtgatccaatgatgtcctttgccgcc
cagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctctcggtggcagccgtgccttgtcaagttccgtcagcaacatgggcttgagcgag
tccagcagcctcgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcagctagtgcacaccttcccgtc
atgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaac
tttgattcactcatctccacacagaacgttgttggtttgaatgtggggagcttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system