KEGG   Delphinapterus leucas (beluga whale): 111164350
Entry
111164350         CDS       T05885                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88 isoform X1
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111164350 (MYD88)
   04064 NF-kappa B signaling pathway
    111164350 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111164350 (MYD88)
   04621 NOD-like receptor signaling pathway
    111164350 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111164350 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111164350 (MYD88)
   05135 Yersinia infection
    111164350 (MYD88)
   05133 Pertussis
    111164350 (MYD88)
   05134 Legionellosis
    111164350 (MYD88)
   05152 Tuberculosis
    111164350 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111164350 (MYD88)
   05161 Hepatitis B
    111164350 (MYD88)
   05171 Coronavirus disease - COVID-19
    111164350 (MYD88)
   05164 Influenza A
    111164350 (MYD88)
   05162 Measles
    111164350 (MYD88)
   05168 Herpes simplex virus 1 infection
    111164350 (MYD88)
   05169 Epstein-Barr virus infection
    111164350 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    111164350 (MYD88)
   05145 Toxoplasmosis
    111164350 (MYD88)
   05140 Leishmaniasis
    111164350 (MYD88)
   05142 Chagas disease
    111164350 (MYD88)
   05143 African trypanosomiasis
    111164350 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 111164350
NCBI-ProteinID: XP_022409680
UniProt: A0A2Y9LJK0
LinkDB
Position
Unknown
AA seq 296 aa
MAEGGPDAGSAPPTPSMSSLPLAALNVRVRRRLSLFLNLRAHVAADWTALAEEMGFEYLE
IRRLETHADPTGSLLDDWQGRPGASVGRLLELLGKLGRDDLLMELGPSIEEDCQKYILKQ
QQEASEKPLQVDSVDSSIPRTRDPAGITICDDPLGQMPECFDAFICYCPSDIQFVQEMIR
ELEQTNHRLKLCVSDRDVLPGTCIWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKSMKKEFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgaaggaggtccggacgcgggctccgcgccccccaccccttccatgtcctccctg
cccctggcagcgctcaacgtgcgagtgcggcgccgcctgtcgctcttcctaaacttgcgg
gcgcatgtggcggccgactggaccgcgctggcggaggagatgggcttcgagtacttggag
atccggcggctggagacgcatgccgaccccacgggcagcctgctggacgactggcaggga
cgacccggcgcttcggtgggccgcctgctcgagctcctcggcaagctgggccgcgacgac
ttgctgatggaactgggacccagcatcgaggaggattgccaaaagtatattctgaagcag
cagcaggaggcgtctgagaagcctttacaggtggactctgtagacagcagcattcctcgg
acgagagatccggcgggcatcaccatttgcgatgaccccctggggcaaatgcctgagtgt
tttgacgccttcatctgctactgccccagcgatatccagtttgtacaggagatgatccgg
gagctggaacagacaaaccatcggctgaagttgtgtgtgtctgaccgcgacgtcctgcct
ggcacctgcatctggtccattgccagtgaactcattgaaaagaggtgccgtcggatggtg
gtggtcgtctctgatgattacttgcaaagcaaggaatgtgacttccagactaagtttgca
ctcagcctctctccaggtgcccatcagaagcgactgatccccatcaagtacaagtcaatg
aagaaagagttccccagcatcctgcggttcatcactatctgtgactacaccaacccctgc
accaagtcctggttctggactcgcctcgccaaggccctgtccctgccctga

DBGET integrated database retrieval system