KEGG   Delphinapterus leucas (beluga whale): 111164391
Entry
111164391         CDS       T05885                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04110  Cell cycle
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04350  TGF-beta signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04919  Thyroid hormone signaling pathway
dle05132  Salmonella infection
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05216  Thyroid cancer
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111164391 (MYC)
   04012 ErbB signaling pathway
    111164391 (MYC)
   04310 Wnt signaling pathway
    111164391 (MYC)
   04350 TGF-beta signaling pathway
    111164391 (MYC)
   04390 Hippo signaling pathway
    111164391 (MYC)
   04630 JAK-STAT signaling pathway
    111164391 (MYC)
   04151 PI3K-Akt signaling pathway
    111164391 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111164391 (MYC)
   04218 Cellular senescence
    111164391 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111164391 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111164391 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164391 (MYC)
   05202 Transcriptional misregulation in cancer
    111164391 (MYC)
   05206 MicroRNAs in cancer
    111164391 (MYC)
   05205 Proteoglycans in cancer
    111164391 (MYC)
   05230 Central carbon metabolism in cancer
    111164391 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111164391 (MYC)
   05225 Hepatocellular carcinoma
    111164391 (MYC)
   05226 Gastric cancer
    111164391 (MYC)
   05216 Thyroid cancer
    111164391 (MYC)
   05221 Acute myeloid leukemia
    111164391 (MYC)
   05220 Chronic myeloid leukemia
    111164391 (MYC)
   05219 Bladder cancer
    111164391 (MYC)
   05213 Endometrial cancer
    111164391 (MYC)
   05224 Breast cancer
    111164391 (MYC)
   05222 Small cell lung cancer
    111164391 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111164391 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111164391 (MYC)
   05161 Hepatitis B
    111164391 (MYC)
   05160 Hepatitis C
    111164391 (MYC)
   05163 Human cytomegalovirus infection
    111164391 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111164391 (MYC)
   05169 Epstein-Barr virus infection
    111164391 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111164391 (MYC)
   03019 Messenger RNA biogenesis [BR:dle03019]
    111164391 (MYC)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    111164391 (MYC)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     111164391 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 111164391
NCBI-ProteinID: XP_022409734
UniProt: A0A2Y9LJB2
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVTVASFSPRGDDGGGGGSFSSADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGHSGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSAAFSPSSDSLLSSAASSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDCPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATTYILSVQAEEQKLISEKDEL
RKRREQLKLKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtgcag
ccttatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgcctgcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtccccgagccgccgctccgggctctgctcgccctcgtacgtcacggtcgcgtccttc
tcccccaggggagacgacggcggcggcggcggcagcttctcctcggcggaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgaccccgac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcttaccaggctgcgcgcaaagacagcggc
agcccgagccctgcccgcgggcacagcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccctcggtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctcccccgactccgccgccttctcgccgtcctcg
gactctctgctctcctccgccgcgtcctccccgcgggccagtcccgagcccctggcgctc
cacgaggagacaccacccaccaccagcagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcgggg
tcaccctctgccggaggccacagcaaacctcctcacagcccgttggtccttaagagatgc
cacgtgtccacccatcagcacaattatgcagcgcccccctccactaggaaggactgtccc
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaatcgc
aaatgtgccagccccaggtcttcggacaccgaggagaatgacaagaggcggacacacaac
gtcttggaacgccagaggagaaacgagctgaaacgcagcttttttgcccttcgtgaccag
atcccggagttagaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
acatacatcctgtccgtccaagcagaggagcaaaagctcatttcagaaaaagacgagttg
cggaagaggcgagaacagttgaaactcaaacttgaacagctacggaactcttgcgcataa

DBGET integrated database retrieval system