KEGG   Delphinapterus leucas (beluga whale): 111164535
Entry
111164535         CDS       T05885                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111164535 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111164535 (FHL1)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 LIM domain-containing proteins
  FHL family proteins
   111164535 (FHL1)
SSDB
Motif
Pfam: LIM zf-C3HC4_3
Other DBs
NCBI-GeneID: 111164535
NCBI-ProteinID: XP_022409964
UniProt: A0A2Y9LJY6
LinkDB
Position
Unknown
AA seq 339 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDNLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRYWHDTCFRCAKCLRSLANETFVAKDNKILCNKCTTREDSPKCKGC
FKPIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHEAKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccctccagctacaaggtgggcaccatggctgagaaa
ttcgactgccactactgcagggacaacctgcagggaaagaagtacgtgcagaaggacggc
caccactgctgcctcaagtgcttcgacaagttctgcgccaacacgtgcgtggagtgccgc
aagcccatcggcgccgactccaaggaggtgcactacaagaaccgctactggcacgacacc
tgcttccgctgcgccaagtgcctccgctccttggccaatgagaccttcgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggactcccccaagtgcaagggctgc
ttcaagccgatcgtggcaggagatcagaacgtggagtacaagggcaccgtctggcacaaa
gactgcttcacctgcagcaactgcaagcaagtcatcgggacaggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccacgaggccaagtttgccaagcactgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccatga

DBGET integrated database retrieval system