KEGG   Delphinapterus leucas (beluga whale): 111164588
Entry
111164588         CDS       T05885                                 

Gene name
ARHGEF6
Definition
(RefSeq) rho guanine nucleotide exchange factor 6 isoform X1
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04810  Regulation of actin cytoskeleton
dle05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111164588 (ARHGEF6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111164588 (ARHGEF6)
Membrane trafficking [BR:dle04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111164588 (ARHGEF6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF RhoGEF67_u1 CH SH3_2 SH3_9 SH3_1 PH CAMSAP_CH Nsp1_C ZapB
Other DBs
NCBI-GeneID: 111164588
NCBI-ProteinID: XP_022410033
UniProt: A0A2Y9LXU3
LinkDB
Position
Unknown
AA seq 780 aa
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSIEKYCLEP
QTEADCTNNVNDFLKGCAALQVEVFDPDDLHAGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTNPQGAVSSTAPGLQRQSKPVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETTPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDDLERFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQYGTCEEKEERYLMLFSSVLIM
LSASPRMSGFIYQGKIPIAGMVVTRLDEIEGNDYTFEITGNIVERTVVHCGNNQDFQDWL
EHLYRLIRGPTSCSSLSKTSSSSCSAHSTFSQSFSSTGQPRGPLEPPQIIKPWSLSCLRP
APPLRPSAALGYKERMSYILKESGKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEED
AQILKVIEAYCTSANFQQGHSSSARKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVD
TVYALKDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECVRAESSSKTSILP
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgaatccagaagaacgcatcgtgacatggcttatatctttgggagtattagattccccc
aaaaagaccatctgtgatccggaggagttcttgaagtcctcactgaaaaatggggtagtg
ctatgcaaactgatcaacagacttaggcctggctctatagaaaagtactgtctggagccc
caaactgaagctgactgcaccaacaacgtcaatgacttcctgaaaggatgtgcagccctt
caagtggaggtatttgatcctgatgaccttcatgcaggggtcaatttctccaaggttctg
agcactcttttagctgtcaacaaagcaacagaagatcagctctcagaaaggccatgtgga
cgttcctcttctcttagcgctgctaatagctctcagacaaacccacagggagcagtttct
agcacagctccagggctgcaaaggcagtcaaagccagtggagatgacggaaaatggaagt
caccagttgatagtaaaggcgagattcaactttaagcagactaatgaagatgaactgtct
gtctgtaaaggggacatcatttatgtcactagagttgaagaaggaggctggtgggaaggc
acattaaatgggagaacaggctggttccctagtaattatgtccgagaaattaaatccagt
gagagacctctctcccccaaggctgtcaaaggatttgaaactactccacttaccaagaat
tattatactgtggtgttacagaatatcttggacactgaaaaagagtatgctaaagaactt
cagtctcttcttgttacttacttaagaccgctgcagtccaataacaatctgagtactgtg
gaatttacatctttattgggaaacttcgaggaagtatgcacgtttcaacagacgctctgc
caagccttggaagaatgttcaaagtttccagaaaaccaacacaaagtaggtggttgtcta
ctgaacctcatgcctcattttaaatctatgtatctggcttactgtgcaaatcatccttca
gctgtaaatgtactcacccagcacagtgatgatctggaacgatttatggaaaatcaaggt
gcatctagcccaggtatcctcattttaacaacaagtctcagcaaacctttcatgcgactg
gaaaagtatgttactctcttgcaagagttggaacggcatatggaggatacgcatccagat
caccaggatattctgaaagcaatcatagcattcaaaactctcatggggcagtgccaagat
ctcagaaagagaaagcagctggagttgcagatactttcggaacctattcaggcatgggaa
ggggaggatattaaaaccttggggaatgtgatctttatgtcgcaagtaatggtgcagtat
ggaacatgtgaggaaaaagaggagcggtacctcatgttattttcaagtgtcttgataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
atggtggtgactagattagatgaaattgaagggaatgactacacatttgaaatcactggt
aacatagtagagagaactgtggtccactgcggcaacaaccaggacttccaggattggctg
gagcatctgtacaggctgataagaggacccacctcttgcagttccttatccaaaacatca
tcgtcatcttgtagtgctcattccacattctcccagtcttttagctctactggacagccc
cgaggacccttggagcctcctcaaattataaaaccgtggagcttaagttgtctgcgacct
gcgcctccacttagaccatcagcagcgctaggttataaagagaggatgtcttatatctta
aaggaatctggtaaaagccccaaaacgatgaagaagtttcttcacaaaagaaagaccgaa
agaaagccatcggaggaggaatatgtcatccgcaaaagtacggctgctctggaagaggac
gctcagattctgaaagtgatcgaagcctactgtaccagtgccaactttcaacaaggccac
agctcaagtgctcgcaaggattccgttccccaagtcttactccccgaggaagagaaactc
atcattgaagaaaccagaagcaacggccagaccatcattgaagaaaagagccttgtcgat
actgtttatgccttgaaggatgaggtcaaagagctgaaacaggagaataaaagaatgaag
cagtgcctggaagaagagttgaaatcaagaagggacctagaaaagctggtccggaggctg
ttgaagcaaactgatgagtgtgttcgcgccgagtccagtagcaagacctccattctccca
taa

DBGET integrated database retrieval system