KEGG   Delphinapterus leucas (beluga whale): 111164603
Entry
111164603         CDS       T05885                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform isoform X1
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle04022  cGMP-PKG signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04371  Apelin signaling pathway
dle04611  Platelet activation
dle04725  Cholinergic synapse
dle04921  Oxytocin signaling pathway
dle05132  Salmonella infection
dle05145  Toxoplasmosis
dle05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111164603 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111164603 (PIK3CG)
   04072 Phospholipase D signaling pathway
    111164603 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    111164603 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    111164603 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111164603 (PIK3CG)
   04062 Chemokine signaling pathway
    111164603 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111164603 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111164603 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    111164603 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111164603 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111164603 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111164603 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111164603 (PIK3CG)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111164603 (PIK3CG)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111164603 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 111164603
NCBI-ProteinID: XP_022410055
UniProt: A0A2Y9LSJ4
LinkDB
Position
Unknown
AA seq 1102 aa
MELENHEQHVVLREDNRRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLHALETSVAADFYHRLSPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHVVQRLAPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDTKLYAMHPWVTSKPLPEYLLKKITNNYIFIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIRNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKAEDHGSINADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCSFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIDMLQKVTMDIKSLSAEKYDVSSQVISQLKQKLEILQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSRHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagaaccatgaacagcacgtggtgctgagagaggacaaccgccgcaggcgc
cggaggatgaagccgcgcagcgcggcggccagcctgtcctccatggagctcatccccatt
gagtttgtgctgcccaccagccagcgcaacaccaagacccccgaaacggcgctgctgcac
gtggctggccacggcaacgtggagcagatgaaggcccaggtgtggctgcacgcgctggag
accagcgtggccgccgacttctaccaccggctcagccccgaccacttcctcctgctctac
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagaccctggac
tgcctgcgctactggaaggtgctgcaccggagccccgggcagatccacgtggtgcagagg
ctcgcgccctcggaggagacgctggccttccagcgccagctcacggccctcattggctac
gacgtcaccgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccgccgcctg
gtgaccccgcgcatggccgaggtggccggccgcgacaccaagctctacgccatgcacccc
tgggtgacgtccaagcccctccccgagtacctgctgaagaagatcaccaacaactacatc
ttcattgtcattcatcgcagcaccaccagccagaccatcaaggtctcagccgatgacacc
ccgggcaccatcctccagagcttctttaccaagatggccaagaagaagtccctgatggat
atccctgaaagccagaacgaacaggactttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggtgagacgcccatcagaaacttccagtgggtgaggcagtgcctcaagaacggg
gaagagattcacctggtgcttgacactccgccggacccagccttggacgaggtgaggaag
gaagagtggccgctggtggacgactgcacgggagtcaccggctaccacgagcagctgacc
atccatgggaaggaccacgagagcgtgttcaccgtgtccctgtgggactgtgaccgcaag
ttcagggtaaaaatcagaggcatcgatatccctgtcctgccccggaacgcggacctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctctgccaaaggagaaccagc
cccaaacccttcacggaggaggtgctgtggaatgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggggctctgctgaacctccagatctactgcggcaaagctccagct
ctgtctggtaaggcctctgcggagactcccagtcccgagtccaggggcaaagctcagctt
ctgtattacgtgaacctgctgctcatagaccaccggttcctcctgcgccacggggagtac
gtgctccacatgtggcagttatccgggaaggcggaagaccatggcagcatcaatgctgac
aagctcacgtctgccaccaacccggacaaggagaactcaatgtccatctccattcttctg
gacaattactgtcaccccatagccttgcctaagcatcggcccacccctgacccggaaggg
gaccgggttcgagcagaaatgcccaatcagcttcggaagcaactagaggcgatcatagcc
accgatccacttaaccctctcacagccgaagacaaagagttgctctggcatttcagatat
gaaagtctgaaggatcccaaagcgtatcctaagctctttagctcagtgaaatggggacag
caagaaattgtggccaaaacatatcaactgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaacaatgcaactcctggactgcagcttttcggatgaaaacgta
agagccattgccgttcagaaactggagagcttggaagacgatgacgtgctacattacctg
ctgcagctggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcacttcttattttggttcttgaga
agtgagatcgcccagtccagacactatcagcagaggtttgcagtgatcctggaagcctac
ctgaggggctgtggcacggccatgctacacgacttcacccagcaagtccaagtaattgac
atgttacaaaaggtgaccatggatatcaaatcgctctctgcagaaaagtatgacgtcagt
tcccaagttatttcccaacttaagcaaaagcttgaaatcctacagaatttgaatctcccc
caaagcttcagagttccgtatgaccctggactgaaagcaggagccctggtgattgaaaaa
tgtaaagtgatggcctccaagaaaaagcccctgtggcttgagtttaaatgtgccgaccct
acagctctgtcaaatgaaacaattggaattatctttaaacacggcgacgatctgcgccag
gacatgctgattttacagattctacgaatcatggagtccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggcgacaaaataggaatgatcgag
atcgtgaaagacgccacgacgatcgccaaaattcagcaaagcacagtgggcaacacgggc
gcctttaaagatgaagtgctgaatcactggctcaaagagaaatgccctattgaagaaaag
tttcaggcagcggtggagagattcgtttattcctgtgctggctactgtgtggcaaccttt
gttcttggaataggtgacagacacaatgacaatattatgatctcagagacaggaaatctg
tttcatatcgactttgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaactccagacttcctgtttgtgatggggacttctggaaag
aagacgagtcgacacttccagaaatttcaggatgtctgcgtcaaggcttacctagccctt
cgtcatcacacaaacctactcatcatcctcttctccatgatgctgatgacaggaatgccc
cagttaaccagcaaagaagatatcgaatacattcgggacgccctgacagtggggaagagc
gaggaggatgctaaaaagtattttctagatcagattgaagtttgcagagacaaaggatgg
actgtgcagttcaactggttcctacatcttgttcttggcatcaaacaaggggagaaacat
tctgcctaa

KEGG   Delphinapterus leucas (beluga whale): 111186004
Entry
111186004         CDS       T05885                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04371  Apelin signaling pathway
dle04611  Platelet activation
dle04725  Cholinergic synapse
dle04921  Oxytocin signaling pathway
dle05145  Toxoplasmosis
dle05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111186004 (PIK3R5)
   04072 Phospholipase D signaling pathway
    111186004 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    111186004 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    111186004 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111186004 (PIK3R5)
   04062 Chemokine signaling pathway
    111186004 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111186004 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111186004 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    111186004 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186004 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111186004 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111186004 (PIK3R5)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111186004 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 111186004
NCBI-ProteinID: XP_022451887
UniProt: A0A2Y9Q8V7
LinkDB
Position
Unknown
AA seq 871 aa
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAAQTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLSTRSHRSSTVTVLLLNPVEVQAEFLTVAD
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDLPGLHRQLQSKTLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTKLQAVGEKAGFLGALDTAQPGKLRTIPIPVARCYTYSWSQDSFDI
LQEILLKEQELLQPGILGDEEDVETEGHDAERDSLLSTSSAALHDSTLSLASSQTSGPSL
SHRLLSSFVSGLSDGVDSGYVEDSQDSSFEWPKRPGSQERRAHRRPGQFNRIYKLFKSTS
QLVLRRDSRTPEGGPDGTLPLRRAGSLCSPCSPLAGPAQPPSRAQRSRSLPQHKLGSQLP
GWALAPASRHQRRCPFLNGDEDPGASTLRVVVFGSDRISGKVARAYSKLRRLESNRPLLT
RFFKLQFFYVPMKRSCGPSASASPAPRSQTPPLPTDSPRHPGPAELGAAPWEESTNDISH
YLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSPAQLPILADMLLYYCRFAARP
VLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAIPLTL
QIIYSKGAISGRSRWSNMEKVCTSVNLSKACRQQEDLDSSTEALTLNLTEVVKRQNPKSK
KGFNQISMSQIKVDKVQIIGSNGCPFAVCLDQDERKILQSVVRCEVSPCYKPETSSLCPP
PQRPSYLQAQTAPDLCSLLCLPIMTFSGALP
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacgacgtgcacggaggaccgcatccagcacgccctggagcgctgc
ttgcacgggctcagcctcagccgccgctccacctcctggtcagctgggctgtgtctcaac
tgctggagcctgcaggagctggtcagcagggatccaggccacttccttatcctcttggag
cagatcctgcagaaaacccgcgaggtccaagagaagggcacctatgacctcctcgccccc
ctggctctgctcttctactccactgtcctctgtactccacacttcccaccagactcagat
ctccttctgaaggcagcccaaacctaccaccgattcctgacctggcccgttccttactgt
agcatctgccaggagctgctcaccttcatcgatgctgaactgaaggccccaggaatctcc
taccagcgactggtgagggccgagcagggcctgtccactaggagtcatcgcagctccact
gtcaccgtactgttgctgaacccggtggaggtgcaggccgagttcctcaccgtggccgac
aagctgagcacgcctgggcactccccgcacagcgcctacaccaccctgctcctgcacgcc
ttccaggccacctttggggcccactgcgacctcccaggtctgcaccgccagctgcagtcc
aagaccctggcagagctcgaggacatcttcacggagacggccgaagcacaggaactggca
tctggcatcggggatgcagctgaggcccggcagtggctcaggaccaagctgcaggcggtg
ggggagaaagccggcttccttggtgccttagacactgcacaacctggcaagctccgtacc
atccccatccctgtcgccaggtgctacacctacagctggagccaggacagcttcgacatc
ctgcaggagatcctgctcaaggaacaggagctgctccaaccaggaatcctgggggacgag
gaggacgtggaaaccgaggggcatgatgccgagagggactcgctgctctccaccagctcg
gcagccttgcacgactccaccctgtcccttgcctcatcccagacctcgggacccagcctc
tcccaccggctgctgagctcctttgtctcgggcctctctgatggcgtggacagcggctac
gtggaagacagccaggacagctcgttcgagtggcccaagaggcctggcagccaggagcgc
cgggcccaccgcaggcccgggcagttcaacaggatctataaactcttcaagagcaccagc
cagctggtgctgcgcagggactcccggaccccggagggtggcccggacggcaccctgccc
ctgcggcgggccggcagcctctgcagcccctgcagccccctggctggcccggcgcagccc
ccgtcccgggcccagcgttcccgctccctgccccagcacaagctcggctcccagctgccc
ggctgggccctggcccccgcctcccgtcaccagcgccgctgccccttcctgaacggggac
gaggaccccggggcctccacgctgcgagttgtggtcttcggctctgatcggatctcgggg
aaggtggcccgggcgtacagcaagctgcggcggctggagagcaaccgtccgctcctcaca
cggttcttcaagcttcagttcttctacgtgcccatgaagcggagctgcgggcccagcgcc
agcgccagcccagcccctcggagccagacgccgccgctccccacagactccccgaggcac
cccggccctgcggagctgggtgcagcaccctgggaggaaagcaccaatgacatctcccac
tacctcggcatgcttgacccctggtatgagcgcaacgtgctgggcctcatgcacctgccc
cctgaagtcctgtgccagcagtctctgaaggctgagtcccggcccctggagggctctcct
gcccagctgcccatcctggcggacatgctgctctattactgccgcttcgctgcccggccg
gtgctgctgcaggtctatcagaccgagctgaccttcatcaccggggagaagacgacagag
atcttcatccactccctggagctgggtcactctgctgccacacgcgccatcaaggcttcg
ggtcctggcagcaagcgactgggcatcgatggtgaccgggaagccatccctctaacacta
cagattatttacagcaagggggccatcagtggacgtagtcgctggagtaacatggagaag
gtctgcacctccgtcaacctcagcaaggcctgccggcagcaggaggacctggactccagc
acggaggccctgacgctaaacctgacagaagtggtgaaaaggcagaaccctaaatccaag
aagggcttcaaccagattagcatgtcgcagatcaaagtggacaaggtgcagattatcggc
tctaacggctgcccctttgccgtgtgcctggaccaggacgagaggaagatcctgcagagt
gtggtcaggtgtgaggtctccccctgctacaagccggagacgagcagcctctgcccccca
ccccagaggccctcctacctgcaggcgcagacggcacccgacctctgctccctgctgtgt
ctgcccatcatgactttcagtggagctctgccctag

KEGG   Delphinapterus leucas (beluga whale): 111186025
Entry
111186025         CDS       T05885                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04371  Apelin signaling pathway
dle04611  Platelet activation
dle04725  Cholinergic synapse
dle04921  Oxytocin signaling pathway
dle05145  Toxoplasmosis
dle05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111186025 (PIK3R6)
   04072 Phospholipase D signaling pathway
    111186025 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    111186025 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    111186025 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111186025 (PIK3R6)
   04062 Chemokine signaling pathway
    111186025 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111186025 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111186025 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    111186025 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186025 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111186025 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111186025 (PIK3R6)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111186025 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 111186025
NCBI-ProteinID: XP_022451943
UniProt: A0A2Y9Q8X7
LinkDB
Position
Unknown
AA seq 881 aa
MRRPGGGRRPGSLRNCRHSGRRQSKGIKPEVGDQGRTRSRRALQVMLRNLAILLKVWRLQ
TPVRARLRHQVVPGWRPPWAGLWTAELQLSQEPALCRKTSTLLSILLPETVTPSSHLPQA
PMESSDVDLDLQRSVRAVLRELSAQAPALPSNQGMWRWSLHKKVERDPGKSPALVRILLR
ELEKAESEDARHVIIPLLHTLMYVLTKATGITEELHRRTYAFCTKLLTLPAPYCTIALDC
AIRLKTETAVPGTLYQRLVIAEQNLTNELYPYRERVFLFVDPELVSPSVCSALLLEIEAA
QGQQTPEACMRHVVSHALQAALGEACEAGVLQRKLQTSSRRALEHYFHAVVAAVEQMASG
PSPSREGHLERLKEIYCSLLGPAAAARGRCGACPSGEPPQDRLPSIPLPSPHITFHLWTN
EEQLWKELVLFLCPRSQLRLSADLEALDLQGLLPDRELARASMLSTDSGIERDLPWGADE
PPTPGSPEVEQARLKRKGGIKKRVWPPDILMPGSWDGPPGLHQRTGRPSGDRGLLPGVSR
LHTARVLVLGDDRMLGRLARAYHSLRKRETQKFCLTPRLSLQLYYIPVLASEKPTASRRS
ELGELAAFLGRADPWYESIVNTLCPAIHKLAEMPLSLDTSQTVDPFILDAITYYVRMGTQ
PIYFQIYAVKIFLSDLSQDPAEDIFLTELKVKIQDSKFPRESLSPRRRGVAEGPGAELSV
RYQKALLSHRTREVTVSLRATGLVLKALPAGDTEVSGSTHCPPTAAPETDHTCLNISVTE
VVKTSNLTGRSFSTVTNTFRSANVQIQSQDQRLLTLLLDKDSCRAYRDVARFEVAPCPEP
CSGAQKSKVLGLSSHQEEIERTKAKAKPLRMPINTFSGIVQ
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgcgaaggcctggaggtgggagacggcctggatcattaaggaactgcaggcattctgga
aggcgtcagagcaaggggataaagcctgaggttggggatcaaggaaggaccagatcaaga
agggccttgcaagtcatgctaaggaatttggccattctcttgaaggtctggaggctgcag
acaccggtcagggctcgtctaagacatcaggtggtcccgggctggaggcctccctgggca
ggactgtggacagccgagctgcagctgagccaagaaccagctctttgcaggaaaacaagc
accttactttccattctgctgcctgagacagtcacaccctcctcacacttaccccaggcc
cccatggagagctcagatgtggacctggacctccagcggagcgtgcgcgctgtgctccga
gagctcagtgcccaggcccctgccctgccgagcaaccaaggcatgtggagatggtccctg
cacaagaaggtcgagcgggatcctggtaagagtccggcactggtccgcatactgctcaga
gaactggagaaggcagaaagtgaggacgcccggcatgtcatcattcccttgctgcacact
ctaatgtacgtgctcactaaggccacgggcatcacagaggagctccaccggagaacctat
gccttttgcacgaagttgctgaccctgcccgccccctactgcaccatcgccctggactgc
gccataaggctgaaaacggagacggccgtcccagggacgctgtaccagaggctggtcatt
gccgagcagaacctgacgaatgagctgtacccctaccgggagagagtgttcctcttcgtg
gatcctgagctggtgtctccctccgtgtgcagtgccctgctgctggagattgaggcggcc
caggggcagcagacaccagaggcctgcatgcgccacgtggtctcccacgccctgcaggcg
gcgctgggggaggcctgcgaggcaggtgtgctgcagaggaagcttcagaccagctcccgc
cgcgccctggagcactatttccacgccgtggtggcagccgtggagcagatggccagcggg
cccagcccaagccgggagggccacctggagaggctgaaggagatttactgctcgctgctg
gggccggcggcggccgccagggggcgctgcggcgcctgtccttcaggtgagcccccccag
gaccggcttccaagcatccctctgcccagcccccatatcaccttccacctgtggaccaat
gaggaacagctctggaaggaactggttctcttcctgtgcccgcgatcccagctgcgcctc
agtgcagacttggaagccttggatctgcagggcctcctgccagaccgggagttggcccgg
gcgtccatgctgtccaccgacagcggcatcgagcgggaccttccttggggggccgacgag
ccgcccacacctggcagccccgaggtggagcaagccaggctgaagcgcaaagggggcatc
aagaagcgggtgtggcccccggacatcctgatgcccggcagctgggatgggccgccgggg
ctgcaccagaggactggcaggcccagcggggatagggggctgctgcctggggtctcccgg
ctgcacacggcccgggtgctggtgctaggggacgaccggatgctggggcgcctggcccgg
gcctaccacagcctcaggaaacgagagacccagaagttctgcctcacccccagactcagc
ctgcagctctactacatccctgtgctggcatctgagaagcccacagcatccaggcgttcg
gagctcggagagttggctgcgttcctgggccgtgcagacccgtggtacgagagcatcgtc
aacaccctgtgccccgccatccacaagctggcagagatgcctctctccctggacacgtcc
cagaccgtagaccccttcatcctggatgccatcacctactatgttcgcatgggcacccaa
cccatctatttccagatctacgcagtcaagatcttcctcagtgacctgagtcaggaccct
gcagaggacatcttcctcaccgagctcaaagtcaagatccaggactccaagttccccaga
gagagcctttcaccccggaggaggggcgtggctgagggcccaggggctgagctctccgtt
cgctaccagaaggccctgctcagccaccgcacccgagaggtcaccgtctccctgcgggcc
accgggctggtcctaaaggcacttccagccggtgacactgaagtttcagggtccacccac
tgccccccaactgctgctccggagacagaccacacatgcctgaatattagcgtgacagag
gttgtcaagacctccaacttgacaggaaggtccttctctacggtgacaaacaccttccgg
tcggctaacgtccagatccaaagccaggaccagaggctgctgacactgttgctggacaag
gacagttgccgcgcgtacagggatgtggccaggttcgaggttgctccctgcccagagccg
tgttctggggcccagaaatccaaggtgctgggactcagctcacaccaggaggagatagaa
aggaccaaagccaaggccaagccccttcgaatgcccatcaacacgttctctggcattgtc
cagtga

DBGET integrated database retrieval system