KEGG   Delphinapterus leucas (beluga whale): 111164604
Entry
111164604         CDS       T05885                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle05144  Malaria
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05211  Renal cell carcinoma
dle05218  Melanoma
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111164604 (HGF)
   04014 Ras signaling pathway
    111164604 (HGF)
   04015 Rap1 signaling pathway
    111164604 (HGF)
   04020 Calcium signaling pathway
    111164604 (HGF)
   04151 PI3K-Akt signaling pathway
    111164604 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111164604 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164604 (HGF)
   05205 Proteoglycans in cancer
    111164604 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111164604 (HGF)
   05226 Gastric cancer
    111164604 (HGF)
   05218 Melanoma
    111164604 (HGF)
   05211 Renal cell carcinoma
    111164604 (HGF)
   05223 Non-small cell lung cancer
    111164604 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    111164604 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111164604 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111164604 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111164604 (HGF)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111164604 (HGF)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111164604 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 111164604
NCBI-ProteinID: XP_022410059
UniProt: A0A2Y9LK73
LinkDB
Position
Unknown
AA seq 729 aa
MWVTKLLPVLLLQHVLLHLLFPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIKT
KKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYEN
KDYIRNCIIGKGGSYKGTVSITKSGIKCQPWDSMIPHEHSFLPSSYRGKDLQENYCRNPR
GEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPH
RHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPME
TTECIQGQGEGYRGIINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAE
SPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMED
LHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLD
HPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRNK
DLKDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAVLDDFVSTIDL
PNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICA
GAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKI
ILTYKVPQS
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagtcttactgctgcagcacgtcctcctccacctcctg
tttcccattgccatcccctatgcagaaggacagaagaaaagaagaaacacacttcatgaa
ttcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaaaaca
aaaaaaatgaacactgcagaccaatgtgccaatagatgtattaggaataaaggacttcca
ttcacttgcaaggcctttgtttttgacaaagcaagaaagcgatgcctctggttccctttc
aatagcatgtcaagtggagtgaaaaaagagtttggccatgaatttgacctctatgaaaac
aaagactacattagaaactgcatcatcggtaaaggaggtagctataagggaacggtatct
atcactaaaagtggcatcaaatgccagccctgggattccatgataccacacgaacacagc
tttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcctcga
ggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtctgt
gacattcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcgaggt
cccatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacgccacat
cggcataaattcttgccagaaagatatcccgacaagggctttgatgataattattgccgc
aatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgggag
tactgtgcaattaaaatgtgcgctcacagtactatgaatgacacggatgtccctatggaa
acaactgaatgcattcaaggtcaaggagaaggttaccggggcatcatcaataccatttgg
aatggaattccctgtcagcgttgggattcccagtatcctcaccagcatgacataactcct
gaaaatttcaagtgcaaggacctaagagaaaactattgccgaaatccagatggggctgag
tcaccgtggtgttttaccactgatccaaacatccgagttggctactgctcccaaattcca
aaatgtgatgtgtcaagtggacaagattgttatcgtgggaatggcaaaaactatatgggc
aatttatccaaaacacgatctggactaacatgttcgatgtgggacaagaacatggaagat
ttacatcggcatatcttttgggaaccagatgctagtaagctgaataagaattactgccgc
aatcctgatgatgatgcccatggtccctggtgttacacggggaatcctctcattccttgg
gattactgccctatttctcgttgtgaaggtgataccacacctacaatagtcaatttagac
catcctgtaatatcttgcgccaaaacaaaacaactgcgagttgtaaatgggattccaaca
cgaacaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtggagga
tcattgataaaggaaagttggattcttactgcaagacagtgtttcccttctcgaaacaaa
gacttgaaagattatgaagcttggcttggaattcatgatgtccatggaagaggagatgag
aaacgcaaacaggttctaaatgttacccaactggtatatgggccggaaggatcagatctg
gtattactgaagcttgctaggcctgctgttctggatgattttgttagtacaattgattta
cctaattatgggtgcacaattcctgaaaaaaccacttgcagtgtttatggctggggctac
actggattgatcaactcggacggtctattacgagtagcacatctctatattatggggaat
gagaaatgcagccaatatcatcaagggaaggtgactctgaatgagtctgaaatatgtgct
ggggctgaaaatattgtatcaggaccatgcgagggagattatggtggcccactggtttgt
gaacaacataaaatgagaatggttcttggtgtcatcgttcctggtcgtggatgtgccatt
ccaaatcgtcctggtatttttgtccgagtggcatattatgcaaaatggatacacaaaatt
atattaacgtataaggtaccacagtcgtag

DBGET integrated database retrieval system